Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PTK6Sample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human PTK6 Polyclonal Antibody | anti-PTK6 antibody

PTK6 Antibody - middle region

Gene Names
PTK6; BRK
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PTK6; Polyclonal Antibody; PTK6 Antibody - middle region; anti-PTK6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VSFLSLPELVNYHRAQSLSHGLRLAAPCRKHEPEPLPHWDDWERPREEFT
Sequence Length
451
Applicable Applications for anti-PTK6 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PTK6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PTK6Sample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PTK6Sample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PTK6 antibody
The protein encoded by this gene is a cytoplasmic nonreceptor protein kinase which may function as an intracellular signal transducer in epithelial tissues. Overexpression of this gene in mammary epithelial cells leads to sensitization of the cells to epidermal growth factor and results in a partially transformed phenotype. Expression of this gene has been detected at low levels in some breast tumors but not in normal breast tissue. The encoded protein has been shown to undergo autophosphorylation. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-PTK6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49 kDa
NCBI Official Full Name
protein-tyrosine kinase 6 isoform 2
NCBI Official Synonym Full Names
protein tyrosine kinase 6
NCBI Official Symbol
PTK6
NCBI Official Synonym Symbols
BRK
NCBI Protein Information
protein-tyrosine kinase 6
UniProt Protein Name
Protein-tyrosine kinase 6
Protein Family
UniProt Gene Name
PTK6
UniProt Synonym Gene Names
BRK
UniProt Entry Name
PTK6_HUMAN

NCBI Description

The protein encoded by this gene is a cytoplasmic nonreceptor protein kinase which may function as an intracellular signal transducer in epithelial tissues. Overexpression of this gene in mammary epithelial cells leads to sensitization of the cells to epidermal growth factor and results in a partially transformed phenotype. Expression of this gene has been detected at low levels in some breast tumors but not in normal breast tissue. The encoded protein has been shown to undergo autophosphorylation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2012]

Uniprot Description

Brk: a tyrosine kinase of the Src family. May function as an intracellular signal transducer in epithelial tissues. Very high level expression in colon and high levels in small intestine and prostate, and low levels in some fetal tissues. Selectively expressed in breast tumors and cell lines, and perhaps in colon and prostate cancers. Also found in melanocytes. Not expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Overexpression in mammary cells leads to EGF sensitization and results in a partially transformed phenotype. Enhances anchorage-independent growth and responsiveness to EGF. RNAi reduces proliferation in breast cancer cells. Kinase-inactive mutant indicates tumor function may be independent of catalytic function.

Protein type: Protein kinase, TK; Protein kinase, tyrosine (non-receptor); Kinase, protein; EC 2.7.10.2; TK group; Src family

Chromosomal Location of Human Ortholog: 20q13.3

Cellular Component: nucleoplasm; ruffle; extrinsic to internal side of plasma membrane; cytoplasm; nucleus

Molecular Function: identical protein binding; protein binding; non-membrane spanning protein tyrosine kinase activity; ATP binding; receptor binding

Biological Process: cell migration; protein amino acid autophosphorylation; innate immune response; tyrosine phosphorylation of Stat3 protein; actin cytoskeleton organization and biogenesis; tyrosine phosphorylation of Stat5 protein; protein amino acid phosphorylation; transmembrane receptor protein tyrosine kinase signaling pathway; regulation of cell proliferation; negative regulation of growth

Research Articles on PTK6

Similar Products

Product Notes

The PTK6 ptk6 (Catalog #AAA3221673) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTK6 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PTK6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PTK6 ptk6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VSFLSLPELV NYHRAQSLSH GLRLAAPCRK HEPEPLPHWD DWERPREEFT. It is sometimes possible for the material contained within the vial of "PTK6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.