Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PTGES rabbit polyclonal antibody. Western Blot analysis of PTGES expression in human liver)

Rabbit anti-Human, Mouse PTGES Polyclonal Antibody | anti-PTGES antibody

PTGES (Prostaglandin E Synthase, Microsomal Glutathione S-transferase 1-like 1, MGST1-L1, p53-induced Gene 12 Protein,PIG12, PGES, MGST1L1) (HRP)

Gene Names
PTGES; PGES; MPGES; PIG12; PP102; PP1294; MGST-IV; MGST1L1; TP53I12; mPGES-1; MGST1-L1
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PTGES; Polyclonal Antibody; PTGES (Prostaglandin E Synthase; Microsomal Glutathione S-transferase 1-like 1; MGST1-L1; p53-induced Gene 12 Protein; PIG12; PGES; MGST1L1) (HRP); anti-PTGES antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PTGES. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Sequence Length
1805
Applicable Applications for anti-PTGES antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PTGES, aa1-152 (NP_004869.1).
Immunogen Sequence
MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PTGES rabbit polyclonal antibody. Western Blot analysis of PTGES expression in human liver)

Western Blot (WB) (PTGES rabbit polyclonal antibody. Western Blot analysis of PTGES expression in human liver)

Western Blot (WB)

(PTGES rabbit polyclonal antibody. Western Blot analysis of PTGES expression in mouse spleen.)

Western Blot (WB) (PTGES rabbit polyclonal antibody. Western Blot analysis of PTGES expression in mouse spleen.)

Western Blot (WB)

(PTGES rabbit polyclonal antibody. Western Blot analysis of PTGES expression in HeLa.)

Western Blot (WB) (PTGES rabbit polyclonal antibody. Western Blot analysis of PTGES expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of PTGES expression in transfected 293T cell line by PTGES polyclonal antibody. Lane 1: PTGES transfected lysate (17.1kD). Lane 2: Non-transfected lysate. )

Western Blot (WB) (Western Blot analysis of PTGES expression in transfected 293T cell line by PTGES polyclonal antibody. Lane 1: PTGES transfected lysate (17.1kD). Lane 2: Non-transfected lysate. )
Related Product Information for anti-PTGES antibody
PTGES is a glutathione-dependent prostaglandin E synthase. The expression of it has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B). Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis. Knockout studies in mice suggest that it may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses.
Product Categories/Family for anti-PTGES antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens prostaglandin E synthase (PTGES), mRNA
NCBI Official Synonym Full Names
prostaglandin E synthase
NCBI Official Symbol
PTGES
NCBI Official Synonym Symbols
PGES; MPGES; PIG12; PP102; PP1294; MGST-IV; MGST1L1; TP53I12; mPGES-1; MGST1-L1
NCBI Protein Information
prostaglandin E synthase
Protein Family

NCBI Description

The protein encoded by this gene is a glutathione-dependent prostaglandin E synthase. The expression of this gene has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B). Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis. Knockout studies in mice suggest that this gene may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses. [provided by RefSeq, Jul 2008]

Research Articles on PTGES

Similar Products

Product Notes

The PTGES (Catalog #AAA6391312) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PTGES (Prostaglandin E Synthase, Microsomal Glutathione S-transferase 1-like 1, MGST1-L1, p53-induced Gene 12 Protein,PIG12, PGES, MGST1L1) (HRP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PTGES can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PTGES for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PTGES, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.