Mouse anti-Human PTGES Monoclonal Antibody | anti-PTGES antibody

PTGES (Prostaglandin E Synthase, Microsomal Glutathione S-transferase 1-like 1, MGST1-L1, p53-induced Gene 12 Protein,PIG12, PGES, MGST1L1) (HRP)

Cat. Num. AAA6154416

• Gene Names: PTGES; PGES; MPGES; PIG12; PP102; PP1294; MGST-IV; MGST1L1; TP53I12; mPGES-1; MGST1-L1
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PTGES; Monoclonal Antibody; PTGES (Prostaglandin E Synthase; Microsomal Glutathione S-transferase 1-like 1; MGST1-L1; p53-induced Gene 12 Protein; PIG12; PGES; MGST1L1) (HRP); anti-PTGES antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2B9
• Specificity: Recognizes human PTGES.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-PTGES antibody: ELISA (EIA), Immunoprecipitation (IP)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-152 from PTGES (AAH08280) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of PTGES transfected lysate using PTGES monoclonal antibody and Protein A Magnetic Bead and immunoblotted with PTGES rabbit polyclonal antibody.)

Related Product Information for anti-PTGES antibody

PTGES is a glutathione-dependent prostaglandin E synthase. The expression of it has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B). Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis. Knockout studies in mice suggest that it may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses.

Product Categories/Family for anti-PTGES antibody

Antibodies; Prostaglandins

NCBI and Uniprot Product Information

• NCBI GI #: 14249816
• NCBI GeneID: 9536
• Molecular Weight: 17,102 Da
• NCBI Official Full Name: Homo sapiens prostaglandin E synthase, mRNA
• NCBI Official Synonym Full Names: prostaglandin E synthase
• NCBI Official Symbol: PTGES
• NCBI Official Synonym Symbols: PGES; MPGES; PIG12; PP102; PP1294; MGST-IV; MGST1L1; TP53I12; mPGES-1; MGST1-L1
• NCBI Protein Information: prostaglandin E synthase
• Protein Family: Prostaglandin E synthase

NCBI Description

The protein encoded by this gene is a glutathione-dependent prostaglandin E synthase. The expression of this gene has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B). Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis. Knockout studies in mice suggest that this gene may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses. [provided by RefSeq, Jul 2008]