Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PSTPIP1Sample Type: NCI-H226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit PSTPIP1 Polyclonal Antibody | anti-PSTPIP1 antibody

PSTPIP1 Antibody - N-terminal region

Gene Names
PSTPIP1; H-PIP; PAPAS; CD2BP1; PSTPIP; CD2BP1L; CD2BP1S
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PSTPIP1; Polyclonal Antibody; PSTPIP1 Antibody - N-terminal region; anti-PSTPIP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLRQRAQAEERYGKELVQIARKAGGQTEINSLRASFDSLKQQMENVGSSH
Sequence Length
397
Applicable Applications for anti-PSTPIP1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human PSTPIP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PSTPIP1Sample Type: NCI-H226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PSTPIP1Sample Type: NCI-H226 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PSTPIP1 antibody
This is a rabbit polyclonal antibody against PSTPIP1. It was validated on Western Blot

Target Description: The protein encoded by this gene binds to the cytoplasmic tail of CD2, an effector of T cell activation and adhesion, negatively affecting CD2-triggered T cell activation. The encoded protein appears to be a scaffold protein and a regulator of the actin cytoskeleton. It has also been shown to bind ABL1, PTPN18, WAS, CD2AP, and PTPN12. Mutations in this gene are a cause of PAPA syndrome.
Product Categories/Family for anti-PSTPIP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
Proline-serine-threonine phosphatase-interacting protein 1
NCBI Official Synonym Full Names
proline-serine-threonine phosphatase interacting protein 1
NCBI Official Symbol
PSTPIP1
NCBI Official Synonym Symbols
H-PIP; PAPAS; CD2BP1; PSTPIP; CD2BP1L; CD2BP1S
NCBI Protein Information
proline-serine-threonine phosphatase-interacting protein 1
UniProt Protein Name
Proline-serine-threonine phosphatase-interacting protein 1
UniProt Gene Name
PSTPIP1
UniProt Synonym Gene Names
CD2BP1; PEST phosphatase-interacting protein 1
UniProt Entry Name
PPIP1_HUMAN

NCBI Description

This gene encodes a cytoskeletal protein that is highly expressed in hemopoietic tissues. This protein functions via its interaction with several different proteins involved in cytoskeletal organization and inflammatory processes. It binds to the cytoplasmic tail of CD2, an effector of T cell activation and adhesion, downregulating CD2-triggered adhesion. It binds PEST-type protein tyrosine phosphatases (PTP) and directs them to c-Abl kinase to mediate c-Abl dephosphorylation, thereby, regulating c-Abl activity. It also interacts with pyrin, which is found in association with the cytoskeleton in myeloid/monocytic cells and modulates immunoregulatory functions. Mutations in this gene are associated with PAPA (pyogenic sterile arthritis, pyoderma gangrenosum, and acne) syndrome. It is hypothesized that the disease-causing mutations compromise physiologic signaling necessary for the maintenance of a proper inflammatory response. [provided by RefSeq, Mar 2016]

Uniprot Description

PSTPIP1: an SH3-domain containing protein that may play a role in vesicle formation and transport. Interacts with PTP-PEST to inhibit WASp-driven actin polymerization and synapse formation.

Protein type: Motility/polarity/chemotaxis; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 15q24.3

Cellular Component: membrane; lamellipodium; perinuclear region of cytoplasm; contractile ring; stress fiber; uropod; cytosol; cleavage furrow

Molecular Function: protein binding; actin binding; protein phosphatase binding

Biological Process: innate immune response; endocytosis; inflammatory response; signal transduction; cell adhesion

Disease: Pyogenic Sterile Arthritis, Pyoderma Gangrenosum, And Acne

Research Articles on PSTPIP1

Similar Products

Product Notes

The PSTPIP1 pstpip1 (Catalog #AAA3216360) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PSTPIP1 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PSTPIP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PSTPIP1 pstpip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLRQRAQAEE RYGKELVQIA RKAGGQTEIN SLRASFDSLK QQMENVGSSH. It is sometimes possible for the material contained within the vial of "PSTPIP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.