Western Blot (WB)
(Host: RabbitTarget Name: PRSS33Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit PRSS33 Polyclonal Antibody | anti-PRSS33 antibody
PRSS33 Antibody - C-terminal region
Gene Names
PRSS33; EOS
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRSS33; Polyclonal Antibody; PRSS33 Antibody - C-terminal region; anti-PRSS33 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSWGKGCALPNRPGVYTSV
Sequence Length
284
Applicable Applications for anti-PRSS33 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PRSS33
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: PRSS33Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PRSS33Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PRSS33 antibody
This is a rabbit polyclonal antibody against PRSS33. It was validated on Western Blot
Target Description: PRSS33 is a Serine protease that has amidolytic activity, cleaving its substrates before Arg residues.
Target Description: PRSS33 is a Serine protease that has amidolytic activity, cleaving its substrates before Arg residues.
Product Categories/Family for anti-PRSS33 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
serine protease 33
NCBI Official Synonym Full Names
serine protease 33
NCBI Official Symbol
PRSS33
NCBI Official Synonym Symbols
EOS
NCBI Protein Information
serine protease 33
UniProt Protein Name
Serine protease 33
Protein Family
UniProt Gene Name
PRSS33
UniProt Entry Name
PRS33_HUMAN
Uniprot Description
PRSS33: Serine protease that has amidolytic activity, cleaving its substrates before Arg residues. Belongs to the peptidase S1 family.
Protein type: Protease; EC 3.4.21.-; Secreted, signal peptide; Secreted
Chromosomal Location of Human Ortholog: 16p13.3
Cellular Component: extracellular space
Molecular Function: serine-type endopeptidase activity
Biological Process: proteolysis
Research Articles on PRSS33
Similar Products
Product Notes
The PRSS33 prss33 (Catalog #AAA3217610) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRSS33 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PRSS33 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PRSS33 prss33 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GYPQGHKDAC QGDSGGPLTC LQSGSWVLVG VVSWGKGCAL PNRPGVYTSV. It is sometimes possible for the material contained within the vial of "PRSS33, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
