Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PROM1 AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)

Rabbit anti-Human PROM1 Polyclonal Antibody | anti-PROM1 antibody

PROM1 antibody - C-terminal region

Gene Names
PROM1; RP41; AC133; CD133; MCDR2; STGD4; CORD12; PROML1; MSTP061
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PROM1; Polyclonal Antibody; PROM1 antibody - C-terminal region; anti-PROM1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELES
Sequence Length
865
Applicable Applications for anti-PROM1 antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PROM1 AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)

Western Blot (WB) (WB Suggested Anti-PROM1 AntibodyTitration: 1.0 ug/mlPositive Control: THP-1 Whole Cell)
Related Product Information for anti-PROM1 antibody
This is a rabbit polyclonal antibody against PROM1. It was validated on Western Blot

Target Description: This gene encodes a pentaspan transmembrane glycoprotein. The protein localizes to membrane protrusions and is often expressed on adult stem cells, where it is thought to function in maintaining stem cell properties by suppressing differentiation. Mutations in this gene have been shown to result in retinitis pigmentosa and Stargardt disease. Expression of this gene is also associated with several types of cancer. This gene is expressed from at least five alternative promoters that are expressed in a tissue-dependent manner. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-PROM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
97kDa
NCBI Official Full Name
prominin-1 isoform 1
NCBI Official Synonym Full Names
prominin 1
NCBI Official Symbol
PROM1
NCBI Official Synonym Symbols
RP41; AC133; CD133; MCDR2; STGD4; CORD12; PROML1; MSTP061
NCBI Protein Information
prominin-1
UniProt Protein Name
Prominin-1
Protein Family
UniProt Gene Name
PROM1
UniProt Synonym Gene Names
PROML1
UniProt Entry Name
PROM1_HUMAN

NCBI Description

This gene encodes a pentaspan transmembrane glycoprotein. The protein localizes to membrane protrusions and is often expressed on adult stem cells, where it is thought to function in maintaining stem cell properties by suppressing differentiation. Mutations in this gene have been shown to result in retinitis pigmentosa and Stargardt disease. Expression of this gene is also associated with several types of cancer. This gene is expressed from at least five alternative promoters that are expressed in a tissue-dependent manner. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]

Uniprot Description

CD133: Binds cholesterol in cholesterol-containing plasma membrane microdomains. Proposed to play a role in apical plasma membrane organization of epithelial cells. During early retinal development acts as a key regulator of disk morphogenesis. Involved in regulation of MAPK and Akt signaling pathways. In neuroblastoma cells suppresses cell differentiation such as neurite outgrowth in a RET-dependent manner. Interacts with CDHR1 and with actin filaments. Isoform 1 is selectively expressed on CD34 hematopoietic stem and progenitor cells in adult and fetal bone marrow, fetal liver, cord blood and adult peripheral blood. Isoform 1 is not detected on other blood cells. Isoform 1 is also expressed in a number of non-lymphoid tissues including retina, pancreas, placenta, kidney, liver, lung, brain and heart. Found in saliva within small membrane particles. Isoform 2 is predominantly expressed in fetal liver, skeletal muscle, kidney, and heart as well as adult pancreas, kidney, liver, lung, and placenta. Isoform 2 is highly expressed in fetal liver, low in bone marrow, and barely detectable in peripheral blood. Isoform 2 is expressed on hematopoietic stem cells and in epidermal basal cells. Expressed in adult retina by rod and cone photoreceptor cells. Belongs to the prominin family. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell surface; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 4p15.32

Cellular Component: stereocilium; extracellular space; cell surface; photoreceptor outer segment; microvillus membrane; endoplasmic reticulum; integral to plasma membrane; apical plasma membrane; plasma membrane; ER-Golgi intermediate compartment; vesicle; brush border

Molecular Function: actinin binding; protein binding; cadherin binding

Biological Process: photoreceptor cell maintenance; retina morphogenesis in camera-type eye

Disease: Macular Dystrophy, Retinal, 2; Stargardt Disease 4; Retinitis Pigmentosa 41; Cone-rod Dystrophy 12

Research Articles on PROM1

Similar Products

Product Notes

The PROM1 prom1 (Catalog #AAA3215099) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PROM1 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PROM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PROM1 prom1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KMKLTFEQVY SDCKKNRGTY GTLHLQNSFN ISEHLNINEH TGSISSELES. It is sometimes possible for the material contained within the vial of "PROM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.