Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Prom1Sample Type: Mouse LiverLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/LaneGel Concentration: 0.12)

Rabbit Prom1 Polyclonal Antibody | anti-PROM1 antibody

Prom1 antibody - N-terminal region

Gene Names
Prom1; Prom; AC133; CD133; Prom-1; Proml1; 4932416E19Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Prom1; Polyclonal Antibody; Prom1 antibody - N-terminal region; anti-PROM1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IILMPLVGCFFCMCRCCNKCGGEMHQRQKQNAPCRRKCLGLSLLVICLLM
Sequence Length
867
Applicable Applications for anti-PROM1 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 85%; Rat: 91%; Zebrafish: 92%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Prom1Sample Type: Mouse LiverLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/LaneGel Concentration: 0.12)

Western Blot (WB) (Host: RabbitTarget Name: Prom1Sample Type: Mouse LiverLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/LaneGel Concentration: 0.12)

Western Blot (WB)

(WB Suggested Anti-Prom1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)

Western Blot (WB) (WB Suggested Anti-Prom1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)
Related Product Information for anti-PROM1 antibody
This is a rabbit polyclonal antibody against Prom1. It was validated on Western Blot

Target Description: Prom1 binds cholesterol in cholesterol-containing plasma membrane microdomains. It is rroposed to play a role in apical plasma membrane organization of epithelial cells. During early during retinal development, Prom1 acts as a key regulator of disk morphogenesis. Prom1 is involved in regulation of MAPK and Akt signaling pathways. In neuroblastoma cells suppresses cell differentiation such as neurite outgrowth in a RET-dependent manner.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
95kDa
NCBI Official Full Name
prominin-1 isoform s2
NCBI Official Synonym Full Names
prominin 1
NCBI Official Symbol
Prom1
NCBI Official Synonym Symbols
Prom; AC133; CD133; Prom-1; Proml1; 4932416E19Rik
NCBI Protein Information
prominin-1
UniProt Protein Name
Prominin-1
Protein Family
UniProt Gene Name
Prom1
UniProt Synonym Gene Names
Prom; Proml1
UniProt Entry Name
PROM1_MOUSE

Uniprot Description

CD133: Binds cholesterol in cholesterol-containing plasma membrane microdomains. Proposed to play a role in apical plasma membrane organization of epithelial cells. During early retinal development acts as a key regulator of disk morphogenesis. Involved in regulation of MAPK and Akt signaling pathways. In neuroblastoma cells suppresses cell differentiation such as neurite outgrowth in a RET-dependent manner. Interacts with CDHR1 and with actin filaments. Isoform 1 is selectively expressed on CD34 hematopoietic stem and progenitor cells in adult and fetal bone marrow, fetal liver, cord blood and adult peripheral blood. Isoform 1 is not detected on other blood cells. Isoform 1 is also expressed in a number of non-lymphoid tissues including retina, pancreas, placenta, kidney, liver, lung, brain and heart. Found in saliva within small membrane particles. Isoform 2 is predominantly expressed in fetal liver, skeletal muscle, kidney, and heart as well as adult pancreas, kidney, liver, lung, and placenta. Isoform 2 is highly expressed in fetal liver, low in bone marrow, and barely detectable in peripheral blood. Isoform 2 is expressed on hematopoietic stem cells and in epidermal basal cells. Expressed in adult retina by rod and cone photoreceptor cells. Belongs to the prominin family. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Cell surface; Membrane protein, integral

Cellular Component: extracellular space; microvillus; cell surface; integral to plasma membrane; endoplasmic reticulum; ER-Golgi intermediate compartment; integral to membrane; cilium; stereocilium; photoreceptor outer segment; cell projection; membrane; apical plasma membrane; plasma membrane; brush border; vesicle

Molecular Function: actinin binding; cadherin binding

Biological Process: photoreceptor cell maintenance; retina morphogenesis in camera-type eye

Research Articles on PROM1

Similar Products

Product Notes

The PROM1 prom1 (Catalog #AAA3215098) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Prom1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Prom1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PROM1 prom1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IILMPLVGCF FCMCRCCNKC GGEMHQRQKQ NAPCRRKCLG LSLLVICLLM. It is sometimes possible for the material contained within the vial of "Prom1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.