Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Park2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Liver)

Rabbit PRKN Polyclonal Antibody | anti-PRKN antibody

PRKN Antibody - C-terminal region

Gene Names
Prkn; Park2
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRKN; Polyclonal Antibody; PRKN Antibody - C-terminal region; anti-PRKN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YTRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEQGQRKVTCEGGNGLGCG
Sequence Length
464
Applicable Applications for anti-PRKN antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 86%; Human: 100%; Mouse: 86%; Pig: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Park2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Liver)

Western Blot (WB) (WB Suggested Anti-Park2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Mouse Liver)
Related Product Information for anti-PRKN antibody
This is a rabbit polyclonal antibody against Park2. It was validated on Western Blot

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase parkin isoform 1
NCBI Official Synonym Full Names
parkin RBR E3 ubiquitin protein ligase
NCBI Official Symbol
Prkn
NCBI Official Synonym Symbols
Park2
NCBI Protein Information
E3 ubiquitin-protein ligase parkin
UniProt Protein Name
E3 ubiquitin-protein ligase parkin
UniProt Gene Name
Park2
UniProt Synonym Gene Names
Prkn
UniProt Entry Name
PRKN2_MOUSE

Uniprot Description

PARK2: a component of a multiprotein E3 ubiquitin ligase complex, catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins, such as BCL2, SYT11, CCNE1, GPR37, STUB1, a 22 kDa O-linked glycosylated isoform of SNCAIP, SEPT5, ZNF746 and AIMP2. Mediates monoubiquitination as well as 'Lys-48'-linked and 'Lys-63'-linked polyubiquitination of substrates depending on the context. Participates in the removal and/or detoxification of abnormally folded or damaged protein by mediating 'Lys-63'-linked polyubiquitination of misfolded proteins such as PARK7: 'Lys-63'- linked polyubiquitinated misfolded proteins are then recognized by HDAC6, leading to their recruitment to aggresomes, followed by degradation. Mediates 'Lys-63'-linked polyubiquitination of SNCAIP, possibly playing a role in Lewy-body formation. Mediates monoubiquitination of BCL2, thereby acting as a positive regulator of autophagy. Promotes the autophagic degradation of dysfunctional depolarized mitochondria. Mediates 'Lys-48'-linked polyubiquitination of ZNF746, followed by degradation of ZNF746 by the proteasome; possibly playing a role in role in regulation of neuron death. Limits the production of reactive oxygen species (ROS). Loss of this ubiquitin ligase activity appears to be the mechanism underlying pathogenesis of PARK2. May protect neurons against alpha synuclein toxicity, proteasomal dysfunction, GPR37 accumulation, and kainate-induced excitotoxicity. May play a role in controlling neurotransmitter trafficking at the presynaptic terminal and in calcium-dependent exocytosis. Regulates cyclin-E during neuronal apoptosis. May represent a tumor suppressor gene. Forms an E3 ubiquitin ligase complex with UBE2L3 or UBE2L6. Mediates 'Lys-63'-linked polyubiquitination by associating with UBE2V1. Part of a SCF-like complex, consisting of PARK2, CUL1 and FBXW7. Part of a complex, including STUB1, HSP70 and GPR37. The amount of STUB1 in the complex increases during ER stress. STUB1 promotes the dissociation of HSP70 from PARK2 and GPR37, thus facilitating PARK2-mediated GPR37 ubiquitination. HSP70 transiently associates with unfolded GPR37 and inhibits the E3 activity of PARK2, whereas, STUB1 enhances the E3 activity of PARK2 through promotion of dissociation of HSP70 from PARK2-GPR37 complexes. Interacts with PSMD4 and PACRG. Interacts with LRRK2. Interacts with RANBP2. Interacts with SUMO1 but not SUMO2, which promotes nuclear localization and autoubiquitination. Interacts (via first RING- type domain) with AIMP2 (via N-terminus). Interacts with PSMA7 and RNF41. Interacts with PINK1. Highly expressed in the brain including the substantia nigra. Expressed in heart, testis and skeletal muscle. Expression is down-regulated or absent in tumor biopsies, and absent in the brain of PARK2 patients. Overexpression protects dopamine neurons from kainate-mediated apoptosis. Found in serum. Belongs to the RBR family. Parkin subfamily. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Ligase; Ubiquitin ligase; Ubiquitin conjugating system; EC 6.3.2.19; EC 6.3.2.-

Cellular Component: Golgi apparatus; endoplasmic reticulum membrane; neuron projection; protein complex; mitochondrion; endoplasmic reticulum; postsynaptic density; cytosol; lipid raft; Golgi membrane; postsynaptic membrane; synaptic vesicle; cell projection; membrane; perinuclear region of cytoplasm; cytoplasm; plasma membrane; synapse; cytoplasmic vesicle; intracellular; nucleus; cell junction; ubiquitin ligase complex

Molecular Function: tubulin binding; identical protein binding; ubiquitin binding; zinc ion binding; coenzyme F420-2 alpha-glutamyl ligase activity; metal ion binding; histone deacetylase binding; ubiquitin-protein ligase activity; ribosomal S6-glutamic acid ligase activity; Hsp70 protein binding; actin binding; protein kinase binding; PDZ domain binding; protein binding; G-protein-coupled receptor binding; ubiquitin conjugating enzyme binding; heat shock protein binding; ubiquitin protein ligase binding; chaperone binding; UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6-diaminopimelate-D-alanyl-D-alanine ligase activity; protein complex binding; coenzyme F420-0 gamma-glutamyl ligase activity; kinase binding; ligase activity

Biological Process: protein monoubiquitination; synaptic transmission, dopaminergic; proteasomal ubiquitin-dependent protein catabolic process; negative regulation of actin filament bundle formation; startle response; protein polyubiquitination; adult locomotory behavior; regulation of protein ubiquitination; protein ubiquitination during ubiquitin-dependent protein catabolic process; regulation of neurotransmitter secretion; protein ubiquitination; locomotory behavior; mitochondrion localization; norepinephrine metabolic process; dopamine metabolic process; negative regulation of insulin secretion; negative regulation of glucokinase activity; negative regulation of protein amino acid phosphorylation; regulation of transcription, DNA-dependent; dopamine uptake; negative regulation of neuron apoptosis; positive regulation of DNA binding; regulation of synaptic transmission; synaptic transmission, glutamatergic; protein autoubiquitination; positive regulation of I-kappaB kinase/NF-kappaB cascade; protein stabilization; transcription, DNA-dependent; learning; response to unfolded protein; regulation of protein transport; cellular protein catabolic process; positive regulation of proteasomal ubiquitin-dependent protein catabolic process; protein metabolic process; mitochondrion degradation; autophagy; positive regulation of transcription from RNA polymerase II promoter; regulation of autophagy

Research Articles on PRKN

Similar Products

Product Notes

The PRKN park2 (Catalog #AAA3206675) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRKN Antibody - C-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PRKN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PRKN park2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YTRYQQYGAE ECVLQMGGVL CPRPGCGAGL LPEQGQRKVT CEGGNGLGCG. It is sometimes possible for the material contained within the vial of "PRKN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.