Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-SMARCAD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Rabbit SMARCAD1 Polyclonal Antibody | anti-SMARCAD1 antibody

SMARCAD1 antibody - N-terminal region

Gene Names
SMARCAD1; ETL1; HEL1; ADERM; BASNS
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
SMARCAD1; Polyclonal Antibody; SMARCAD1 antibody - N-terminal region; anti-SMARCAD1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EEDEFNDDQSIKKTRLDHGEESNESAESSSNWEKQESIVLKLQKEFPNFD
Sequence Length
1026
Applicable Applications for anti-SMARCAD1 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 93%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SMARCAD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-SMARCAD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-SMARCAD1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
Related Product Information for anti-SMARCAD1 antibody
This is a rabbit polyclonal antibody against SMARCAD1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: SMARCAD1 belongs to the SNF2/RAD54 helicase family. It contains 2 CUE domains, 1 helicase ATP-binding domain, and 1 helicase C-terminal domain. It is a probable ATP-dependent DNA helicase.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
117kDa
NCBI Official Full Name
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 isoform b
NCBI Official Synonym Full Names
SWI/SNF-related, matrix-associated actin-dependent regulator of chromatin, subfamily a, containing DEAD/H box 1
NCBI Official Symbol
SMARCAD1
NCBI Official Synonym Symbols
ETL1; HEL1; ADERM; BASNS
NCBI Protein Information
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1
UniProt Protein Name
SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1
UniProt Gene Name
SMARCAD1
UniProt Synonym Gene Names
KIAA1122; hHEL1
UniProt Entry Name
SMRCD_HUMAN

NCBI Description

This gene encodes a member of the SNF subfamily of helicase proteins. The encoded protein plays a critical role in the restoration of heterochromatin organization and propagation of epigenetic patterns following DNA replication by mediating histone H3/H4 deacetylation. Mutations in this gene are associated with adermatoglyphia. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

SMARCAD1: an ubiquitous enzyme with ATP-dependent DNA helicase activity. Belongs to the SNF2/RAD54 helicase family. Two alternatively spliced human isoforms have been described.

Protein type: EC 3.6.4.12; Helicase; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 4q22.3

Cellular Component: nucleoplasm; heterochromatin; nuclear matrix; nuclear replication fork

Molecular Function: protein binding; nucleic acid binding; DNA binding; helicase activity; ATP binding

Biological Process: chromatin remodeling; regulation of DNA recombination; positive regulation of transcription, DNA-dependent; ATP-dependent chromatin remodeling; DNA double-strand break processing; nucleotide metabolic process; chromatin modification; chromosome separation; protein homooligomerization

Disease: Adermatoglyphia

Research Articles on SMARCAD1

Similar Products

Product Notes

The SMARCAD1 smarcad1 (Catalog #AAA3202159) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SMARCAD1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SMARCAD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SMARCAD1 smarcad1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EEDEFNDDQS IKKTRLDHGE ESNESAESSS NWEKQESIVL KLQKEFPNFD. It is sometimes possible for the material contained within the vial of "SMARCAD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.