Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PRKCB expression in transfected 293T cell line by PRKCB polyclonal antibody. Lane 1: PRKCB1 transfected lysate (76.9kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human PRKCB Polyclonal Antibody | anti-PRKCB antibody

PRKCB (Protein Kinase C beta Type, PKC-B, PKC-beta, PKCB, PRKCB1, MGC41878) (FITC)

Gene Names
PRKCB; PKCB; PRKCB1; PRKCB2; PKCI(2); PKCbeta; PKC-beta
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PRKCB; Polyclonal Antibody; PRKCB (Protein Kinase C beta Type; PKC-B; PKC-beta; PKCB; PRKCB1; MGC41878) (FITC); anti-PRKCB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PRKCB.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-PRKCB antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PRKCB, aa1-671 (NP_997700.1).
Immunogen Sequence
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVINV
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PRKCB expression in transfected 293T cell line by PRKCB polyclonal antibody. Lane 1: PRKCB1 transfected lysate (76.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PRKCB expression in transfected 293T cell line by PRKCB polyclonal antibody. Lane 1: PRKCB1 transfected lysate (76.9kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between PRKCB and CHUK HeLa cells were stained with PRKCB rabbit purified polyclonal 1:1200 and CHUK mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between PRKCB and CHUK HeLa cells were stained with PRKCB rabbit purified polyclonal 1:1200 and CHUK mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-PRKCB antibody
PKC (Protein kinase C) is a calcium-dependent and phospholipid-dependent enzyme that is activated in vivo by the lipid diacylglycerol. PKC has been shown to be involved in signal transduction and various aspects of neoplastic transformation. PKC contains an amino terminal regulatory domain and a carboxy terminal catalytic domain joined by a hinge region. Cleavage of protein kinase C in vitro results in the generation of two functional fragments corresponding to these two domains.
Product Categories/Family for anti-PRKCB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
77,012 Da
NCBI Official Full Name
protein kinase C beta type isoform 1
NCBI Official Synonym Full Names
protein kinase C beta
NCBI Official Symbol
PRKCB
NCBI Official Synonym Symbols
PKCB; PRKCB1; PRKCB2; PKCI(2); PKCbeta; PKC-beta
NCBI Protein Information
protein kinase C beta type
UniProt Protein Name
Protein kinase C beta type
Protein Family
UniProt Gene Name
PRKCB
UniProt Synonym Gene Names
PKCB; PRKCB1; PKC-B; PKC-beta
UniProt Entry Name
KPCB_HUMAN

NCBI Description

Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. The protein encoded by this gene is one of the PKC family members. This protein kinase has been reported to be involved in many different cellular functions, such as B cell activation, apoptosis induction, endothelial cell proliferation, and intestinal sugar absorption. Studies in mice also suggest that this kinase may also regulate neuronal functions and correlate fear-induced conflict behavior after stress. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

PKCB: an AGC kinase of the PKC family. A classical PKC downstream of many mitogenic receptors. Activates the NF-kappaB signaling pathway in B cells after antigen-receptor signaling. Two splice-variant isoforms have been described.

Protein type: EC 2.7.11.13; Motility/polarity/chemotaxis; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; Protein kinase, AGC; AGC group; PKC family; Alpha subfamily

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: nucleoplasm; membrane; cytoplasm; plasma membrane; cytosol; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; protein kinase C activity; androgen receptor binding; ligand-dependent nuclear receptor transcription coactivator activity; protein kinase C binding; histone binding; zinc ion binding; calcium channel regulator activity; chromatin binding; ATP binding

Biological Process: platelet activation; positive regulation of I-kappaB kinase/NF-kappaB cascade; transcription, DNA-dependent; B cell activation; apoptosis; positive regulation of B cell receptor signaling pathway; mitotic nuclear envelope disassembly; negative regulation of insulin receptor signaling pathway; signal transduction; protein amino acid phosphorylation; positive regulation of vascular endothelial growth factor receptor signaling pathway; activation of NF-kappaB transcription factor; regulation of transcription from RNA polymerase II promoter; cellular calcium ion homeostasis; synaptic transmission; positive regulation of angiogenesis; B cell receptor signaling pathway; lipoprotein transport; calcium ion transport; response to hypoxia; mitotic cell cycle; blood coagulation; vascular endothelial growth factor receptor signaling pathway

Research Articles on PRKCB

Similar Products

Product Notes

The PRKCB prkcb (Catalog #AAA6390706) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRKCB (Protein Kinase C beta Type, PKC-B, PKC-beta, PKCB, PRKCB1, MGC41878) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRKCB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PRKCB prkcb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PRKCB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.