Rabbit Prkaa1 Polyclonal Antibody | anti-PRKAA1 antibody

Prkaa1 antibody - N-terminal region

Cat. Num. AAA3211427

• Gene Names: Prkaa1; AI194361; AI450832; AL024255; AMPKalpha1; C130083N04Rik
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: Prkaa1; Polyclonal Antibody; Prkaa1 antibody - N-terminal region; anti-PRKAA1 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: STPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRH
• Sequence Length: 548

• Applicable Applications for anti-PRKAA1 antibody: Western Blot (WB)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 79%; Yeast: 77%; Zebrafish: 93%
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-PRKAA1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Sample Type: Rat primary hepatocytesSample Type: rat hepatocyte (50ug)Primary Dilution: 1:1000Secondary Antibody: Donkey anti-Rabbit HRPSecondary Dilution: 1:10,000Image Submitted By: Dustin Singer,INRA/AgroParistech )

Western Blot (WB)

(Prkaa1 antibody - N-terminal region validated by WB using mouse liver at 1:1000.)

Related Product Information for anti-PRKAA1 antibody

This is a rabbit polyclonal antibody against Prkaa1. It was validated on Western Blot

Target Description: Prkaa1 is a catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism.

Product Categories/Family for anti-PRKAA1 antibody

Polyclonal; Drugs and Drug Metabolism; Various; Autophagy; Phosphorylation; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 94681061
• NCBI GeneID: 105787
• NCBI Accession #: NP_001013385
• NCBI GenBank Nucleotide #: NM_001013367
• UniProt Accession #: Q5EG47
• Molecular Weight: 60kDa
• NCBI Official Full Name: 5'-AMP-activated protein kinase catalytic subunit alpha-1 isoform 1
• NCBI Official Synonym Full Names: protein kinase, AMP-activated, alpha 1 catalytic subunit
• NCBI Official Symbol: Prkaa1
• NCBI Official Synonym Symbols: AI194361; AI450832; AL024255; AMPKalpha1; C130083N04Rik
• NCBI Protein Information: 5'-AMP-activated protein kinase catalytic subunit alpha-1
• UniProt Protein Name: 5'-AMP-activated protein kinase catalytic subunit alpha-1
• UniProt Gene Name: Prkaa1
• UniProt Synonym Gene Names: HMGCR kinase

Uniprot Description

Catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Regulates lipid synthesis by phosphorylating and inactivating lipid metabolic enzymes such as ACACA, ACACB, GYS1, HMGCR and LIPE; regulates fatty acid and cholesterol synthesis by phosphorylating acetyl-CoA carboxylase (ACACA and ACACB) and hormone-sensitive lipase (LIPE) enzymes, respectively. Regulates insulin-signaling and glycolysis by phosphorylating IRS1, PFKFB2 and PFKFB3. AMPK stimulates glucose uptake in muscle by increasing the translocation of the glucose transporter SLC2A4/GLUT4 to the plasma membrane, possibly by mediating phosphorylation of TBC1D4/AS160. Regulates transcription and chromatin structure by phosphorylating transcription regulators involved in energy metabolism such as CRTC2/TORC2, FOXO3, histone H2B, HDAC5, MEF2C, MLXIPL/ChREBP, EP300, HNF4A, p53/TP53, SREBF1, SREBF2 and PPARGC1A. Acts as a key regulator of glucose homeostasis in liver by phosphorylating CRTC2/TORC2, leading to CRTC2/TORC2 sequestration in the cytoplasm. In response to stress, phosphorylates 'Ser-36' of histone H2B (H2BS36ph), leading to promote transcription. Acts as a key regulator of cell growth and proliferation by phosphorylating TSC2, RPTOR and ATG1/ULK1: in response to nutrient limitation, negatively regulates the mTORC1 complex by phosphorylating RPTOR component of the mTORC1 complex and by phosphorylating and activating TSC2. In response to nutrient limitation, promotes autophagy by phosphorylating and activating ATG1/ULK1. AMPK also acts as a regulator of circadian rhythm by mediating phosphorylation of CRY1, leading to destabilize it. May regulate the Wnt signaling pathway by phosphorylating CTNNB1, leading to stabilize it. Also has tau-protein kinase activity: in response to amyloid beta A4 protein (APP) exposure, activated by CAMKK2, leading to phosphorylation of MAPT/TAU; however the relevance of such data remains unclear in vivo. Also phosphorylates CFTR, EEF2K, KLC1, NOS3 and SLC12A1.