Western Blot (WB)
(Sample Type: Human 293TSample Type: HEK 293 (10ug)Primary Dilution: 1:1000Secondary Antibody: conjugated goat anti-rabbitSecondary Dilution: 1:10,000Image Submitted By: Amy GrayBrigham Young University )
Rabbit Cct7 Polyclonal Antibody | anti-CCT7 antibody
Cct7 antibody - C-terminal region
Gene Names
Cct7; Ccth; Cctz; AA408524; AL022769
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Cct7; Polyclonal Antibody; Cct7 antibody - C-terminal region; anti-CCT7 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVDPPAPSAGRGRGQ
Sequence Length
544
Applicable Applications for anti-CCT7 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Sample Type: Human 293TSample Type: HEK 293 (10ug)Primary Dilution: 1:1000Secondary Antibody: conjugated goat anti-rabbitSecondary Dilution: 1:10,000Image Submitted By: Amy GrayBrigham Young University )
Western Blot (WB)
(Sample Type: Human 293TSample Type: HEK 293 (10ug)Primary Dilution: 1:1000Secondary Antibody: conjugated goat anti-rabbitSecondary Dilution: 1:10,000Image Submitted By: Amy GrayBrigham Young University )
Western Blot (WB)
(Sample Type: Human 293TCct7 antibody - C-terminal region validated by WB using 293T cells lysate at 1:1,000 dilution for antibody samples and 1:10,000 for secondary antibodies.)
Western Blot (WB)
(Sample Type: Human 293TCct7 antibody - C-terminal region validated by WB using 293T cells lysate at 1:1,000 dilution for antibody samples and 1:10,000 for secondary antibodies.)
Related Product Information for anti-CCT7 antibody
This is a rabbit polyclonal antibody against Cct7. It was validated on Western Blot
Target Description: Cct7 is a molecular chaperone; It assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin.
Target Description: Cct7 is a molecular chaperone; It assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin.
Product Categories/Family for anti-CCT7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60kDa
NCBI Official Full Name
T-complex protein 1 subunit eta
NCBI Official Synonym Full Names
chaperonin containing Tcp1, subunit 7 (eta)
NCBI Official Symbol
Cct7
NCBI Official Synonym Symbols
Ccth; Cctz; AA408524; AL022769
NCBI Protein Information
T-complex protein 1 subunit eta
UniProt Protein Name
T-complex protein 1 subunit eta
Protein Family
UniProt Gene Name
Cct7
UniProt Synonym Gene Names
Ccth; TCP-1-eta
UniProt Entry Name
TCPH_MOUSE
Research Articles on CCT7
Similar Products
Product Notes
The CCT7 cct7 (Catalog #AAA3210445) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cct7 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Cct7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CCT7 cct7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FVWEPAMVRI NALTAASEAA CLIVSVDETI KNPRSTVDPP APSAGRGRGQ. It is sometimes possible for the material contained within the vial of "Cct7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
