Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Sample Type: Human optic nerve headSample Type: human optic nerve head (frozen)Blue: DAPIRed: GfapPrimary Dilution: 1:250Image Submitted By: Geraint ParfittGavin Herbert Eye InstituteSee Customer Feedback tab for detailed information.)

Rabbit Gfap Polyclonal Antibody | anti-GFAP antibody

Gfap antibody - N-terminal region

Gene Names
Gfap; AI836096
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
Gfap; Polyclonal Antibody; Gfap antibody - N-terminal region; anti-GFAP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAEL
Sequence Length
418
Applicable Applications for anti-GFAP antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type: Human optic nerve headSample Type: human optic nerve head (frozen)Blue: DAPIRed: GfapPrimary Dilution: 1:250Image Submitted By: Geraint ParfittGavin Herbert Eye InstituteSee Customer Feedback tab for detailed information.)

Immunohistochemistry (IHC) (Sample Type: Human optic nerve headSample Type: human optic nerve head (frozen)Blue: DAPIRed: GfapPrimary Dilution: 1:250Image Submitted By: Geraint ParfittGavin Herbert Eye InstituteSee Customer Feedback tab for detailed information.)

Immunohistochemistry (IHC)

(Rabbit Anti-GFAP AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Heart Muscle TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:600Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-GFAP AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Heart Muscle TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:600Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Gfap antibody - N-terminal region validated by WB using Mouse Thymus at 1ug/ml.)

Western Blot (WB) (Gfap antibody - N-terminal region validated by WB using Mouse Thymus at 1ug/ml.)
Related Product Information for anti-GFAP antibody
This is a rabbit polyclonal antibody against Gfap. It was validated on Western Blot

Target Description: GFAP, a class-III intermediate filament, is a cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells.
Product Categories/Family for anti-GFAP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
glial fibrillary acidic protein isoform 2
NCBI Official Synonym Full Names
glial fibrillary acidic protein
NCBI Official Symbol
Gfap
NCBI Official Synonym Symbols
AI836096
NCBI Protein Information
glial fibrillary acidic protein
UniProt Protein Name
Glial fibrillary acidic protein
UniProt Gene Name
Gfap
UniProt Synonym Gene Names
GFAP

Uniprot Description

GFAP: a class-III intermediate filament protein. A cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. An additional transcript variant isoform has been described, but its full length sequence has not been determined.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 11 E1|11 66.48 cM

Cellular Component: cell body; cell projection; cytoplasm; intermediate filament; intermediate filament cytoskeleton; intracellular; membrane; myelin sheath

Molecular Function: identical protein binding; integrin binding; kinase binding; protein binding; structural constituent of cytoskeleton; structural molecule activity

Biological Process: astrocyte development; Bergmann glial cell differentiation; extracellular matrix organization; intermediate filament organization; intermediate filament-based process; negative regulation of neuron projection development; neuron projection regeneration; positive regulation of Schwann cell proliferation; regulation of chaperone-mediated autophagy; regulation of neurotransmitter uptake; response to wounding

Research Articles on GFAP

Similar Products

Product Notes

The GFAP gfap (Catalog #AAA3211770) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Gfap antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's Gfap can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the GFAP gfap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FSLAGALNAG FKETRASERA EMMELNDRFA SYIEKVRFLE QQNKALAAEL. It is sometimes possible for the material contained within the vial of "Gfap, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.