Western Blot (WB)
(Host: RabbitTarget Name: PRDX2Sample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse PRDX2 Polyclonal Antibody | anti-PRDX2 antibody
PRDX2 Antibody-C-terminal region
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PRDX2; Polyclonal Antibody; PRDX2 Antibody-C-terminal region; peroxiredoxin-2; TR; PRP; TPx; TSA; TDX1; NkefB; PrxII; TPx-B; Tdpx1; Torin; Band-8; AL022839; anti-PRDX2 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
GRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
Applicable Applications for anti-PRDX2 antibody
Western Blot (WB)
Protein Size
198 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse PRDX2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: PRDX2Sample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: PRDX2Sample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PRDX2 antibody
Description of Target: Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2.
NCBI and Uniprot Product Information
NCBI GeneID
UniProt Accession #
Molecular Weight
22kDa
UniProt Protein Name
Peroxiredoxin-2
Protein Family
UniProt Gene Name
Prdx2
UniProt Synonym Gene Names
Tdpx1; Tpx; TSA
Uniprot Description
Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2.
Similar Products
Product Notes
The PRDX2 prdx2 (Catalog #AAA3249722) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRDX2 Antibody-C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PRDX2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PRDX2 prdx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GRSVDEALRL VQAFQYTDEH GEVCPAGWKP GSDTIKPNVD DSKEYFSKHN. It is sometimes possible for the material contained within the vial of "PRDX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
