Fibroblast growth factor 12 (FGF12) Recombinant Protein | FGF12 recombinant protein

Recombinant Human Fibroblast growth factor 12 (FGF12)

Cat. Num. AAA961079

• Gene Names: FGF12; FHF1; FGF12B
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Fibroblast growth factor 12 (FGF12); Recombinant Human Fibroblast growth factor 12 (FGF12); Fibroblast growth factor 12; FGF-12; Fibroblast growth factor homologous factor 1; FHF-1; Myocyte-activating factor; FGF12 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-181aa; Full Length of Isoform 2
• Sequence: MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
• Sequence Length: 243

• Species: Homo sapiens (Human)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for FGF12 recombinant protein

Involved in nervous system development and function. Promote neuronal excitability by elevating the voltage dependence of neuronal sodium channel SCN8A fast inactivation.

Product Categories/Family for FGF12 recombinant protein

Cardiovascular

NCBI and Uniprot Product Information

• NCBI GI #: 21614511
• NCBI GeneID: 2257
• NCBI Accession #: NP_004104.3
• NCBI GenBank Nucleotide #: NM_004113.5
• UniProt Accession #: P61328; O35339; P70376; Q8TBG5; Q92912; Q93001; B2R6B7; B2R976
• Molecular Weight: 47.4 kDa
• NCBI Official Full Name: fibroblast growth factor 12 isoform 2
• NCBI Official Synonym Full Names: fibroblast growth factor 12
• NCBI Official Symbol: FGF12
• NCBI Official Synonym Symbols: FHF1; FGF12B
• NCBI Protein Information: fibroblast growth factor 12; FHF-1; FGF-12; myocyte-activating factor; fibroblast growth factor 12B; fibroblast growth factor FGF-12b; fibroblast growth factor homologous factor 1
• UniProt Protein Name: Fibroblast growth factor 12
• Protein Family: Fibroblast growth factor
• UniProt Gene Name: FGF12
• UniProt Synonym Gene Names: FGF12B; FHF1; FGF-12; FHF-1
• UniProt Entry Name: FGF12_HUMAN

NCBI Description

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This growth factor lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

FGF12: Probably involved in nervous system development and function. Belongs to the heparin-binding growth factors family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; Cytokine

Chromosomal Location of Human Ortholog: 3q28

Cellular Component: extracellular space; nucleus

Molecular Function: heparin binding; growth factor activity; sodium channel regulator activity; fibroblast growth factor receptor binding

Biological Process: nervous system development; synaptic transmission; fibroblast growth factor receptor signaling pathway; cell-cell signaling; adult locomotory behavior; neuromuscular process; heart development; JNK cascade; signal transduction