Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of U-87MG cells, using PRDM12 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Rabbit anti-Human, Mouse PRDM12 Polyclonal Antibody | anti-PRDM12 antibody

PRDM12 Rabbit pAb

Gene Names
PRDM12; PFM9
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
PRDM12; Polyclonal Antibody; PRDM12 Rabbit pAb; HSAN8; PFM9; anti-PRDM12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
LGIFSKTWIKAGTEMGPFTGRVIAPEHVDICKNNNLMWEVFNEDGTVRYFIDASQEDHRSWMTYIKCARNEQEQNLEVVQIGTSIFYKAIEMIPPDQELLVWYGNSHNTFLGIPGVPGLEEDQKKNKHEDFHPADSAAGPAGRMRCVICHRGFNSRSNLRSHMRIHTLDKPFVCRFCNRRFSQSSTLRNHVRLHTGERPYKCQVCQSAYSQLAGLRAHQKSARHRPPSTAL
Applicable Applications for anti-PRDM12 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 100-330 of human PRDM12 (NP_067632.2).
Positive Samples
U-87MG
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of U-87MG cells, using PRDM12 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Western Blot (WB) (Western blot analysis of extracts of U-87MG cells, using PRDM12 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)
Related Product Information for anti-PRDM12 antibody
Background: This gene encodes a transcriptional regulator of sensory neuronal specification that plays a critical role in pain perception. The encoded protein contains an N-terminal PRDI-BF1 and RIZ homology (PR) domain, a SET domain, and three C-terminal C2H2 zinc finger DNA-binding domains. Naturally occurring mutations in this gene are associated with congenital insensitivity to pain (CIP), and hereditary sensory and autonomic neuropathies (HSAN's) affecting peripheral sensory and autonomic neurons. Deregulation of this gene is associated with solid cancers and hematological malignancies including chronic myeloid leukaemia. [provided by RefSeq, Mar 2017]

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,403 Da
NCBI Official Full Name
PR domain zinc finger protein 12
NCBI Official Synonym Full Names
PR domain containing 12
NCBI Official Symbol
PRDM12
NCBI Official Synonym Symbols
PFM9
NCBI Protein Information
PR domain zinc finger protein 12; PR domain-containing protein 12; PR-domain containing protein 12; PR-domain zinc finger protein 12
UniProt Protein Name
PR domain zinc finger protein 12
UniProt Gene Name
PRDM12
UniProt Synonym Gene Names
PFM9
UniProt Entry Name
PRD12_HUMAN

Uniprot Description

PRDM12: May be involved in transcriptional regulation.

Protein type: Methyltransferase, protein lysine, predicted; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 9q34.12

Cellular Component: nucleus

Molecular Function: methyltransferase activity; DNA binding; metal ion binding

Biological Process: methylation; neurogenesis; regulation of transcription, DNA-dependent; transcription, DNA-dependent

Disease: Neuropathy, Hereditary Sensory And Autonomic, Type Viii

Research Articles on PRDM12

Similar Products

Product Notes

The PRDM12 prdm12 (Catalog #AAA9142986) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PRDM12 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's PRDM12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the PRDM12 prdm12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LGIFSKTWIK AGTEMGPFTG RVIAPEHVDI CKNNNLMWEV FNEDGTVRYF IDASQEDHRS WMTYIKCARN EQEQNLEVVQ IGTSIFYKAI EMIPPDQELL VWYGNSHNTF LGIPGVPGLE EDQKKNKHED FHPADSAAGP AGRMRCVICH RGFNSRSNLR SHMRIHTLDK PFVCRFCNRR FSQSSTLRNH VRLHTGERPY KCQVCQSAYS QLAGLRAHQK SARHRPPSTA L. It is sometimes possible for the material contained within the vial of "PRDM12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.