Rabbit CHCHD2 Polyclonal Antibody | anti-CHCHD2 antibody

[KO Validated] CHCHD2 Rabbit pAb

Cat. Num. AAA9142391

• Gene Names: CHCHD2; C7orf17
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Affinity purification
• Synonyms: CHCHD2; Polyclonal Antibody; [KO Validated] CHCHD2 Rabbit pAb; C7orf17; MNRR1; NS2TP; PARK22; anti-CHCHD2 antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Sequence: TLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCR

• Applicable Applications for anti-CHCHD2 antibody: Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: WB: 1:500-1:2000; IHC: 1:50-1:200; IF: 1:50-1:200
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 75-145 of human CHCHD2 (NP_057223.1).
• Cellular Location: Nucleus
• Positive Samples: HT-29, 293T, HepG2, U-87MG, mouse brain
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using CHCHD2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded Mouse kidney using [KO Validated] CHCHD2 Rabbit pAb at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded Rat ovary using [KO Validated] CHCHD2 Rabbit pAb at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded Human colon carcinoma using [KO Validated] CHCHD2 Rabbit pAb at dilution of 1:100 (40x lens).)

Immunofluorescence (IF)

(Immunofluorescence analysis of C6 cells using CHCHD2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF)

(Immunofluorescence analysis of L929 cells using CHCHD2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF)

(Immunofluorescence analysis of U-2 OS cells using CHCHD2 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Related Product Information for anti-CHCHD2 antibody

Background: The protein encoded by this gene belongs to a class of eukaryotic CX(9)C proteins characterized by four cysteine residues spaced ten amino acids apart from one another. These residues form disulfide linkages that define a CHCH fold. In response to stress, the protein translocates from the mitochondrial intermembrane space to the nucleus where it binds to a highly conserved 13 nucleotide oxygen responsive element in the promoter of cytochrome oxidase 4I2, a subunit of the terminal enzyme of the electron transport chain. In concert with recombination signal sequence-binding protein J, binding of this protein activates the oxygen responsive element at four percent oxygen. In addition, it has been shown that this protein is a negative regulator of mitochondria-mediated apoptosis. In response to apoptotic stimuli, mitochondrial levels of this protein decrease, allowing BCL2-associated X protein to oligomerize and activate the caspase cascade. Pseudogenes of this gene are found on multiple chromosomes. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

• NCBI GI #: 7705851
• NCBI GeneID: 51142
• NCBI Accession #: NP_057223.1
• NCBI GenBank Nucleotide #: NM_016139.2
• UniProt Accession #: Q9Y6H1; Q498C3; Q6NZ50
• Molecular Weight: 15,513 Da
• NCBI Official Full Name: coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial
• NCBI Official Synonym Full Names: coiled-coil-helix-coiled-coil-helix domain containing 2
• NCBI Official Symbol: CHCHD2
• NCBI Official Synonym Symbols: C7orf17
• NCBI Protein Information: coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial; NS2TP; 16.7kD protein; HCV NS2 trans-regulated protein; aging-associated gene 10 protein
• UniProt Protein Name: Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial
• Protein Family: Coiled-coil-helix-coiled-coil-helix domain-containing protein
• UniProt Gene Name: CHCHD2
• UniProt Synonym Gene Names: C7orf17; NS2TP
• UniProt Entry Name: CHCH2_HUMAN

Uniprot Description

CHCHD2: Transcription factor. Binds to the oxygen responsive element of COX4I2 and activates its transcription under hypoxia conditions (4% oxygen), as well as normoxia conditions (20% oxygen) (PubMed:23303788). {ECO:0000269|PubMed:23303788}. Up-regulated by hypoxia (4% oxygen) (at protein level). {ECO:0000269|PubMed:23303788}. Interacts with RBPJ. {ECO:0000269|PubMed:23303788}

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 7p11.2

Cellular Component: mitochondrion