Western Blot (WB)
(PLAC1L antibody (MBS5302464) used at 0.5 ug/ml to detect target protein.)
Rabbit PLAC1L Polyclonal Antibody | anti-PLAC1L antibody
PLAC1L antibody
Gene Names
OOSP2; PLAC1L; TMEM122
Applications
Western Blot
Purity
Affinity purified
Synonyms
PLAC1L; Polyclonal Antibody; PLAC1L antibody; Polyclonal PLAC1L; Anti-PLAC1L; Placenta-Specific 1-Like; PLAC-1; TMEM122; PLAC1; PLAC 1; FLJ36198; anti-PLAC1L antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
PLAC1L antibody was raised against the middle region of PLAC1L
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLAC1L antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
158
Applicable Applications for anti-PLAC1L antibody
Western Blot (WB)
Application Notes
WB: 0.5 ug/ml
Biological Significance
The function of PLAC1 protein is not widely studied, and is yet to be elucidated fully.
Cross-Reactivity
Human
Immunogen
PLAC1L antibody was raised using the middle region of PLAC1L corresponding to a region with amino acids YLVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQEIHLECSTSRKSVW
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(PLAC1L antibody (MBS5302464) used at 0.5 ug/ml to detect target protein.)
Western Blot (WB)
(PLAC1L antibody (MBS5302464) used at 0.5 ug/ml to detect target protein.)
Related Product Information for anti-PLAC1L antibody
Rabbit polyclonal PLAC1L antibody raised against the middle region of PLAC1L
Product Categories/Family for anti-PLAC1L antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
18 kDa (MW of target protein)
NCBI Official Full Name
Placenta-specific 1-like
NCBI Official Synonym Full Names
oocyte secreted protein 2
NCBI Official Symbol
OOSP2
NCBI Official Synonym Symbols
PLAC1L; TMEM122
NCBI Protein Information
oocyte-secreted protein 2
UniProt Protein Name
Oocyte-secreted protein 2
UniProt Gene Name
OOSP2
UniProt Synonym Gene Names
PLAC1L; TMEM122
UniProt Entry Name
OOSP2_HUMAN
Uniprot Description
PLAC1L: Belongs to the PLAC1 family.
Protein type: Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 11q12.1
Cellular Component: extracellular region
Similar Products
Product Notes
The PLAC1L oosp2 (Catalog #AAA5302464) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PLAC1L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.5 ug/ml. Researchers should empirically determine the suitability of the PLAC1L oosp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PLAC1L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
