Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CPNE3 is 0.1 ng/ml as a capture antibody.)

Mouse CPNE3 Monoclonal Antibody | anti-CPNE3 antibody

CPNE3 (Copine III, CPN3, KIAA0636, PRO1071) (Biotin)

Gene Names
CPNE3; CPN3; PRO1071
Applications
Western Blot
Purity
Purified
Synonyms
CPNE3; Monoclonal Antibody; CPNE3 (Copine III; CPN3; KIAA0636; PRO1071) (Biotin); Copine III; PRO1071; anti-CPNE3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F4
Specificity
Recognizes CPNE3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-CPNE3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CPNE3 (NP_003900.1, 164aa-244aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EFHKQTSDGNWLMVHRTEVVKNNLNPVWRPFKISLNSLCYGDMDKTIKVECYDYDNDGSHDLIGTFQTTMTKLKEASRSSP
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CPNE3 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CPNE3 is 0.1 ng/ml as a capture antibody.)

Western Blot (WB)

(CPNE3 monoclonal antibody (M02), clone 4F4. Western Blot analysis of CPNE3 expression in MCF-7.)

Western Blot (WB) (CPNE3 monoclonal antibody (M02), clone 4F4. Western Blot analysis of CPNE3 expression in MCF-7.)
Related Product Information for anti-CPNE3 antibody
Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a protein which contains two type II C2 domains in the amino-terminus and an A domain-like sequence in the carboxy-terminus. The A domain mediates interactions between integrins and extracellular ligands. [provided by RefSeq]
Product Categories/Family for anti-CPNE3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60,131 Da
NCBI Official Full Name
copine-3
NCBI Official Synonym Full Names
copine 3
NCBI Official Symbol
CPNE3
NCBI Official Synonym Symbols
CPN3; PRO1071
NCBI Protein Information
copine-3
UniProt Protein Name
Copine-3
Protein Family
UniProt Gene Name
CPNE3
UniProt Synonym Gene Names
CPN3; KIAA06361 PublicationManual assertion based on opinion iniRef.2

NCBI Description

Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a protein which contains two type II C2 domains in the amino-terminus and an A domain-like sequence in the carboxy-terminus. The A domain mediates interactions between integrins and extracellular ligands. [provided by RefSeq, Aug 2008]

Uniprot Description

Calcium-dependent phospholipid-binding protein that plays a role in ERBB2-mediated tumor cell migration in response to growth factor heregulin stimulation (PubMed:20010870).

Research Articles on CPNE3

Similar Products

Product Notes

The CPNE3 cpne3 (Catalog #AAA6174619) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CPNE3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CPNE3 cpne3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CPNE3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.