Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PPIL2 Antibody Titration: 0.2-1 ug/mlPositive Control: COLO205 cell lysate)

Rabbit PPIL2 Polyclonal Antibody | anti-PPIL2 antibody

PPIL2 antibody - middle region

Gene Names
PPIL2; CYC4; CYP60; UBOX7; Cyp-60; hCyP-60
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PPIL2; Polyclonal Antibody; PPIL2 antibody - middle region; anti-PPIL2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKIIDPDEEKAKQDPSYYLKNTNAETRETLQELYKEFKGDEILAATMKAP
Sequence Length
520
Applicable Applications for anti-PPIL2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PPIL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PPIL2 Antibody Titration: 0.2-1 ug/mlPositive Control: COLO205 cell lysate)

Western Blot (WB) (WB Suggested Anti-PPIL2 Antibody Titration: 0.2-1 ug/mlPositive Control: COLO205 cell lysate)
Related Product Information for anti-PPIL2 antibody
This is a rabbit polyclonal antibody against PPIL2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PPIL2 is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 vir
Product Categories/Family for anti-PPIL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
RING-type E3 ubiquitin-protein ligase PPIL2 isoform a
NCBI Official Synonym Full Names
peptidylprolyl isomerase like 2
NCBI Official Symbol
PPIL2
NCBI Official Synonym Symbols
CYC4; CYP60; UBOX7; Cyp-60; hCyP-60
NCBI Protein Information
RING-type E3 ubiquitin-protein ligase PPIL2; peptidyl-prolyl cis-trans isomerase-like 2
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase-like 2
UniProt Gene Name
PPIL2
UniProt Synonym Gene Names
PPIaseCurated
UniProt Entry Name
PPIL2_HUMAN

NCBI Description

This gene is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. This protein interacts with the proteinase inhibitor eglin c and is localized in the nucleus. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2015]

Uniprot Description

PPIL2: a peptidylprolyl isomerase (PPIase) of the cyclophilin-type family. PPIases accelerate the folding of proteins by catalyzing the cis-trans isomerization of proline imidic peptide bonds. Two alternatively-spliced isoforms have been described.

Protein type: Ligase; Cyclophilin; Ubiquitin conjugating system; EC 5.2.1.8; Spliceosome; Ubiquitin ligase; Isomerase

Chromosomal Location of Human Ortholog: 22q11.21

Cellular Component: nucleoplasm; Golgi lumen; cytoplasm; plasma membrane; nucleus

Molecular Function: protein binding; peptidyl-prolyl cis-trans isomerase activity; ligase activity

Biological Process: protein polyubiquitination; protein peptidyl-prolyl isomerization; protein folding; blood coagulation; leukocyte migration

Research Articles on PPIL2

Similar Products

Product Notes

The PPIL2 ppil2 (Catalog #AAA3212005) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPIL2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PPIL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPIL2 ppil2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MKIIDPDEEK AKQDPSYYLK NTNAETRETL QELYKEFKGD EILAATMKAP. It is sometimes possible for the material contained within the vial of "PPIL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.