Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PPIE Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysatePPIE is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit PPIE Polyclonal Antibody | anti-PPIE antibody

PPIE antibody - middle region

Gene Names
PPIE; CYP33; CYP-33
Reactivity
Guinea Pig, Human, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
PPIE; Polyclonal Antibody; PPIE antibody - middle region; anti-PPIE antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Human, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSG
Sequence Length
235
Applicable Applications for anti-PPIE antibody
Western Blot (WB)
Homology
Guinea Pig: 100%; Human: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PPIE
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PPIE Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysatePPIE is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Western Blot (WB) (WB Suggested Anti-PPIE Antibody Titration: 2.5ug/mlPositive Control: Jurkat cell lysatePPIE is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-PPIE antibody
This is a rabbit polyclonal antibody against PPIE. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PPIE is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities and also exhibit RNA-binding activityThe protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities and also exhibit RNA-binding activity. Three alternatively spliced transcript variants encoding distinct isoforms have been observed.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Synonym Full Names
peptidylprolyl isomerase E
NCBI Official Symbol
PPIE
NCBI Official Synonym Symbols
CYP33; CYP-33
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase E
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase E
UniProt Gene Name
PPIE
UniProt Synonym Gene Names
CYP33; PPIase E
UniProt Entry Name
PPIE_HUMAN

NCBI Description

The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein contains a highly conserved cyclophilin (CYP) domain as well as an RNA-binding domain. It was shown to possess PPIase and protein folding activities, and it also exhibits RNA-binding activity. Alternative splicing results in multiple transcript variants. A related pseudogene, which is also located on chromosome 1, has been identified. [provided by RefSeq, Aug 2010]

Uniprot Description

PPIE: PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. Combines RNA-binding and PPIase activities. May be involved in muscle- and brain-specific processes. May be involved in pre-mRNA splicing. Belongs to the cyclophilin-type PPIase family. PPIase E subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Isomerase; Spliceosome; RNA splicing; EC 5.2.1.8; Cyclophilin

Chromosomal Location of Human Ortholog: 1p32

Cellular Component: nucleus

Molecular Function: protein binding; peptidyl-prolyl cis-trans isomerase activity; RNA binding; nucleotide binding; cyclosporin A binding

Biological Process: nuclear mRNA splicing, via spliceosome; protein peptidyl-prolyl isomerization; positive regulation of viral genome replication; protein folding; regulation of transcription, DNA-dependent

Research Articles on PPIE

Similar Products

Product Notes

The PPIE ppie (Catalog #AAA3205370) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPIE antibody - middle region reacts with Guinea Pig, Human, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PPIE can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPIE ppie for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RIIPQFMCQG GDFTNHNGTG GKSIYGKKFD DENFILKHTG PGLLSMANSG. It is sometimes possible for the material contained within the vial of "PPIE, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.