Western Blot (WB)
(Western Blot analysis of GMPR2 expression in transfected 293T cell line by GMPR2 polyclonal antibody. Lane 1: GMPR2 transfected lysate (37.9kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human GMPR2 Polyclonal Antibody | anti-GMPR2 antibody
GMPR2 (GMP Reductase 2, Guanosine 5'-monophosphate Oxidoreductase 2, Guanosine Monophosphate Reductase 2) (HRP)
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GMPR2; Polyclonal Antibody; GMPR2 (GMP Reductase 2; Guanosine 5'-monophosphate Oxidoreductase 2; Guanosine Monophosphate Reductase 2) (HRP); anti-GMPR2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GMPR2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-GMPR2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human GMPR2, aa1-348 (NP_001002000.1).
Immunogen Sequence
MPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEAC
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of GMPR2 expression in transfected 293T cell line by GMPR2 polyclonal antibody. Lane 1: GMPR2 transfected lysate (37.9kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of GMPR2 expression in transfected 293T cell line by GMPR2 polyclonal antibody. Lane 1: GMPR2 transfected lysate (37.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-GMPR2 antibody
Catalyzes the irreversible NADPH dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. Plays a role in modulating cellular differentiation.
Product Categories/Family for anti-GMPR2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
34,597 Da
NCBI Official Full Name
GMP reductase 2 isoform 2
NCBI Official Synonym Full Names
guanosine monophosphate reductase 2
NCBI Official Symbol
GMPR2
NCBI Protein Information
GMP reductase 2; guanosine 5'-monophosphate oxidoreductase 2; guanosine monophosphate reductase isolog
UniProt Protein Name
GMP reductase 2
Protein Family
UniProt Gene Name
GMPR2
UniProt Synonym Gene Names
Guanosine monophosphate reductase 2
UniProt Entry Name
GMPR2_HUMAN
Uniprot Description
GMPR2: Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. Plays a role in modulating cellular differentiation. Belongs to the IMPDH/GMPR family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: EC 1.7.1.7; Nucleotide Metabolism - purine; Oxidoreductase
Chromosomal Location of Human Ortholog: 14q12
Cellular Component: cytosol
Molecular Function: GMP reductase activity; metal ion binding
Biological Process: nucleobase, nucleoside and nucleotide metabolic process; purine salvage; GMP metabolic process; purine base metabolic process
Research Articles on GMPR2
Similar Products
Product Notes
The GMPR2 gmpr2 (Catalog #AAA6380004) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GMPR2 (GMP Reductase 2, Guanosine 5'-monophosphate Oxidoreductase 2, Guanosine Monophosphate Reductase 2) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GMPR2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GMPR2 gmpr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GMPR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
