Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PPAP2A antibody used at 2.5 ug/ml to detect target protein.)

Rabbit PPAP2A Polyclonal Antibody | anti-PPAP2A antibody

PPAP2A Antibody

Reactivity
Human, Mouse, Zebra Fish
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
PPAP2A; Polyclonal Antibody; PPAP2A Antibody; Rabbit Polyclonal PPAP2A Antibody raised against the middle region of PPAP2A; Polyclonal PPAP2A antibody; Anti-PPAP2A antibody; PPAPA 2 antibody; PAP2alpha2 antibody; LLP1a antibody; PAP2 antibody; PAP-2a antibody; PAP2a2 antibody; PPAPA 2; PPAPA-2 antibody; LPP1 antibody; PPAPA-2; PAPalpha1 antibody; Phosphatidic Acid Phosphatase Type 2A antibody; anti-PPAP2A antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Zebra Fish
Clonality
Polyclonal
Specificity
PPAP2A antibody was raised against the middle region of PPAP2A
Purity/Purification
Total IgG Protein A purified
Form/Format
Liquid; in 1x PBS buffer with 0.09% (w/v) Sodium Azide and 2% Sucrose.
Concentration
1 mg/ml (varies by lot)
Applicable Applications for anti-PPAP2A antibody
Western Blot (WB)
Application Notes
This is a rabbit polyclonal antibody against PPAP2A, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein.
WB: 2.5 ug/ml
Immunogen
PPAP2A antibody was raised using the middle region of PPAP2A corresponding to a region with amino acids DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL
Cross-Reactivity
Human,Mouse,ZebraFish
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(PPAP2A antibody used at 2.5 ug/ml to detect target protein.)

Western Blot (WB) (PPAP2A antibody used at 2.5 ug/ml to detect target protein.)
Related Product Information for anti-PPAP2A antibody
PPAP2A is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is an integral membrane glycoprotein, and has been shown to be a surface enzyme that plays an active role in the hydrolysis and uptake of lipids from extracellular space.
Product Categories/Family for anti-PPAP2A antibody

Similar Products

Product Notes

The PPAP2A (Catalog #AAA5313169) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPAP2A Antibody reacts with Human, Mouse, Zebra Fish and may cross-react with other species as described in the data sheet. AAA Biotech's PPAP2A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). This is a rabbit polyclonal antibody against PPAP2A, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. WB: 2.5 ug/ml. Researchers should empirically determine the suitability of the PPAP2A for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPAP2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.