Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-POU2F1 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293TPOU2F1 is supported by BioGPS gene expression data to be expressed in HEK293T)

Rabbit POU2F1 Polyclonal Antibody | anti-POU2F1 antibody

POU2F1 antibody - N-terminal region

Gene Names
POU2F1; OCT1; OTF1; oct-1B
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
POU2F1; Polyclonal Antibody; POU2F1 antibody - N-terminal region; anti-POU2F1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQP
Sequence Length
743
Applicable Applications for anti-POU2F1 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 92%; Guinea Pig: 85%; Human: 100%; Mouse: 92%; Pig: 100%; Rabbit: 100%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human POU2F1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-POU2F1 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293TPOU2F1 is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB) (WB Suggested Anti-POU2F1 Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293TPOU2F1 is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-POU2F1 antibody
This is a rabbit polyclonal antibody against POU2F1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: POU2F1 is a member of the POU family that represents the double-stranded DNA binding proteins specifically binding to the block C region.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76kDa
NCBI Official Full Name
POU domain, class 2, transcription factor 1 isoform 1
NCBI Official Synonym Full Names
POU class 2 homeobox 1
NCBI Official Symbol
POU2F1
NCBI Official Synonym Symbols
OCT1; OTF1; oct-1B
NCBI Protein Information
POU domain, class 2, transcription factor 1
UniProt Protein Name
POU domain, class 2, transcription factor 1
UniProt Gene Name
POU2F1
UniProt Synonym Gene Names
OCT1; OTF1; Oct-1; OTF-1
UniProt Entry Name
PO2F1_HUMAN

NCBI Description

The OCT1 transcription factor was among the first identified members of the POU transcription factor family (summarized by Sturm et al., 1993 [PubMed 8314572]). Members of this family contain the POU domain, a 160-amino acid region necessary for DNA binding to the octameric sequence ATGCAAAT.[supplied by OMIM, Jul 2010]

Uniprot Description

Oct1: a ubiquitous transcription factor that binds to the octamer motif (5'-ATTTGCAT-3') and activates the promoters of the genes for some small nuclear RNAs (snRNA) and of genes such as those for histone H2B and immunoglobulins. Modulates transcription transactivation by NR3C1, AR and PGR. Phosphorylation apparently inhibits its interaction with DNA. Four splice variant isoforms have been described. Isoform 2 is lymphocyte specific.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 1q24.2

Cellular Component: nucleoplasm; transcription factor complex; intracellular membrane-bound organelle; nucleus

Molecular Function: protein binding; sequence-specific DNA binding; transcription factor activity

Biological Process: transcription from RNA polymerase III promoter; gene expression; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; olfactory placode formation

Research Articles on POU2F1

Similar Products

Product Notes

The POU2F1 pou2f1 (Catalog #AAA3224594) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POU2F1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's POU2F1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the POU2F1 pou2f1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AISTAQAQAF LGHLHQVQLA GTSLQAAAQS LNVQSKSNEE SGDSQQPSQP. It is sometimes possible for the material contained within the vial of "POU2F1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.