Western Blot (WB)
(WB Suggested Anti-POLR3B Antibody Titration: 0.2-1 ug/mlPositive Control: Human heart)
Rabbit POLR3B Polyclonal Antibody | anti-POLR3B antibody
POLR3B antibody - C-terminal region
Gene Names
POLR3B; C128; HLD8; RPC2; INMAP
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
POLR3B; Polyclonal Antibody; POLR3B antibody - C-terminal region; anti-POLR3B antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQED
Sequence Length
1133
Applicable Applications for anti-POLR3B antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human POLR3B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-POLR3B Antibody Titration: 0.2-1 ug/mlPositive Control: Human heart)
Western Blot (WB)
(WB Suggested Anti-POLR3B Antibody Titration: 0.2-1 ug/mlPositive Control: Human heart)
Related Product Information for anti-POLR3B antibody
This is a rabbit polyclonal antibody against POLR3B. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: POLR3B belongs to the RNA polymerase beta chain family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3B is the second largest core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. It is proposed to contribute to the polymerase catalytic activity and forms the polymerase active center together with the largest subunit. Pol III is composed of mobile elements and RPC2 is part of the core element with the central large cleft and probably a clamp element that moves to open and close the cleft.
Target Description: POLR3B belongs to the RNA polymerase beta chain family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3B is the second largest core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. It is proposed to contribute to the polymerase catalytic activity and forms the polymerase active center together with the largest subunit. Pol III is composed of mobile elements and RPC2 is part of the core element with the central large cleft and probably a clamp element that moves to open and close the cleft.
Product Categories/Family for anti-POLR3B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
128kDa
NCBI Official Full Name
DNA-directed RNA polymerase III subunit RPC2 isoform 1
NCBI Official Synonym Full Names
RNA polymerase III subunit B
NCBI Official Symbol
POLR3B
NCBI Official Synonym Symbols
C128; HLD8; RPC2; INMAP
NCBI Protein Information
DNA-directed RNA polymerase III subunit RPC2
UniProt Protein Name
DNA-directed RNA polymerase III subunit RPC2
UniProt Gene Name
POLR3B
UniProt Synonym Gene Names
RNA polymerase III subunit C2
UniProt Entry Name
RPC2_HUMAN
NCBI Description
This gene encodes the second largest subunit of RNA polymerase III, the polymerase responsible for synthesizing transfer and small ribosomal RNAs in eukaryotes. The largest subunit and the encoded protein form the catalytic center of RNA polymerase III. Mutations in this gene are a cause of hypomyelinating leukodystrophy. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]
Research Articles on POLR3B
Similar Products
Product Notes
The POLR3B polr3b (Catalog #AAA3209185) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POLR3B antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's POLR3B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the POLR3B polr3b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IEKVMISSNA EDAFLIKMLL RQTRRPEIGD KFSSRHGQKG VCGLIVPQED. It is sometimes possible for the material contained within the vial of "POLR3B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
