Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ATOH7 expression in transfected 293T cell line by ATOH7 MaxPab polyclonal antibody.Lane 1: ATOH7 transfected lysate(16.9 KDa).Lane 2: Non-transfected lysate.)

Rabbit anti-Human ATOH7 Polyclonal Antibody | anti-ATOH7 antibody

ATOH7 (Atonal Homolog 7 (Drosophila), Math5, bHLHa13) (APC)

Gene Names
ATOH7; Math5; NCRNA; RNANC; PHPVAR; bHLHa13
Reactivity
Human
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
ATOH7; Polyclonal Antibody; ATOH7 (Atonal Homolog 7 (Drosophila); Math5; bHLHa13) (APC); Atonal Homolog 7 (Drosophila); bHLHa13; anti-ATOH7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ATOH7.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-ATOH7 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ATOH7 (NP_660161.1, 1aa-152aa) full-length human protein.
Immunogen Sequence
MKSCKPSGPPAGARVAPPCAGGTECAGTCAGAGRLESAARRRLAANARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAERFGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMAT
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ATOH7 expression in transfected 293T cell line by ATOH7 MaxPab polyclonal antibody.Lane 1: ATOH7 transfected lysate(16.9 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ATOH7 expression in transfected 293T cell line by ATOH7 MaxPab polyclonal antibody.Lane 1: ATOH7 transfected lysate(16.9 KDa).Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified MaxPab antibody to ATOH7 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of purified MaxPab antibody to ATOH7 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of purified MaxPab antibody to ATOH7 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of purified MaxPab antibody to ATOH7 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-ATOH7 antibody
ATOH7 is a member of the family of basic helix-loop-helix (bHLH) proteins with similarity to Drosophila 'atonal,' a proneural bHLH gene that controls photoreceptor development (Brown et al., 2002 [PubMed 11889557]).[supplied by OMIM]
Product Categories/Family for anti-ATOH7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,871 Da
NCBI Official Full Name
protein atonal homolog 7
NCBI Official Synonym Full Names
atonal homolog 7 (Drosophila)
NCBI Official Symbol
ATOH7
NCBI Official Synonym Symbols
Math5; NCRNA; RNANC; PHPVAR; bHLHa13
NCBI Protein Information
protein atonal homolog 7; helix-loop-helix protein hATH-5; class A basic helix-loop-helix protein 13
UniProt Protein Name
Protein atonal homolog 7
Protein Family
UniProt Gene Name
ATOH7
UniProt Synonym Gene Names
ATH5; BHLHA13; bHLHa13; hATH5
UniProt Entry Name
ATOH7_HUMAN

Similar Products

Product Notes

The ATOH7 atoh7 (Catalog #AAA6450542) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATOH7 (Atonal Homolog 7 (Drosophila), Math5, bHLHa13) (APC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATOH7 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ATOH7 atoh7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATOH7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.