Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Polr2cSample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)

Rabbit POLR2C Polyclonal Antibody | anti-POLR2C antibody

POLR2C Antibody - C-terminal region

Gene Names
POLR2C; RPB3; RPB31; hRPB33; hsRPB3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
POLR2C; Polyclonal Antibody; POLR2C Antibody - C-terminal region; anti-POLR2C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERLGDLGPR
Sequence Length
332
Applicable Applications for anti-POLR2C antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of mouse POLR2C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Polr2cSample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: Polr2cSample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-POLR2C antibody
This is a rabbit polyclonal antibody against Polr2c. It was validated on Western Blot

Target Description: This gene encodes the third largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains a cysteine rich region and exists as a heterodimer with another polymerase subunit, POLR2J. These two subunits form a core subassembly unit of the polymerase. A pseudogene has been identified on chromosome 21.
Product Categories/Family for anti-POLR2C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
DNA-directed RNA polymerase II subunit RPB3
NCBI Official Synonym Full Names
RNA polymerase II subunit C
NCBI Official Symbol
POLR2C
NCBI Official Synonym Symbols
RPB3; RPB31; hRPB33; hsRPB3
NCBI Protein Information
DNA-directed RNA polymerase II subunit RPB3
UniProt Protein Name
DNA-directed RNA polymerase II subunit RPB3
UniProt Gene Name
POLR2C
UniProt Synonym Gene Names
RNA polymerase II subunit 3; RNA polymerase II subunit B3; RPB33
UniProt Entry Name
RPB3_HUMAN

NCBI Description

This gene encodes the third largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains a cysteine rich region and exists as a heterodimer with another polymerase subunit, POLR2J. These two subunits form a core subassembly unit of the polymerase. A pseudogene has been identified on chromosome 21. [provided by RefSeq, Jul 2008]

Uniprot Description

POLR2C: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB3 is part of the core element with the central large cleft and the clamp element that moves to open and close the cleft. Belongs to the archaeal RpoD/eukaryotic RPB3 RNA polymerase subunit family.

Protein type: DNA-binding; Nucleotide Metabolism - purine; Transcription initiation complex; Nucleotide Metabolism - pyrimidine

Chromosomal Location of Human Ortholog: 16q13-q21

Cellular Component: nucleoplasm; microtubule cytoskeleton; cytoplasm; DNA-directed RNA polymerase II, core complex; nucleus

Molecular Function: protein dimerization activity; DNA binding

Biological Process: transcription from RNA polymerase II promoter; nuclear mRNA splicing, via spliceosome; transcription initiation from RNA polymerase II promoter; mRNA capping; viral reproduction; positive regulation of viral transcription; nucleotide-excision repair; somatic stem cell maintenance; transcription-coupled nucleotide-excision repair; RNA splicing; RNA elongation from RNA polymerase II promoter; gene expression; DNA repair

Research Articles on POLR2C

Similar Products

Product Notes

The POLR2C polr2c (Catalog #AAA3213502) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POLR2C Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's POLR2C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the POLR2C polr2c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YDPDNALRHT VYPKPEEWPK SEYSELDEDE SQAPYDPNGK PERLGDLGPR. It is sometimes possible for the material contained within the vial of "POLR2C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.