Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PNLIP Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)

Rabbit PNLIP Polyclonal Antibody | anti-PNLIP antibody

PNLIP antibody - C-terminal region

Gene Names
PNLIP; PL; PTL; PNLIPD
Reactivity
Cow, Dog, Horse, Human, Pig
Applications
Western Blot
Purity
Protein A purified
Synonyms
PNLIP; Polyclonal Antibody; PNLIP antibody - C-terminal region; anti-PNLIP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQ
Sequence Length
465
Applicable Applications for anti-PNLIP antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 86%; Horse: 85%; Human: 100%; Pig: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human PNLIP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PNLIP Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-PNLIP Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-PNLIP antibody
This is a rabbit polyclonal antibody against PNLIP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: PNLIP is a member of the lipase gene family. It encodes a carboxyl esterase that hydrolyzes insoluble, emulsified triglycerides, and is essential for the efficient digestion of dietary fats. This gene is expressed specifically in the pancreas.
Product Categories/Family for anti-PNLIP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
pancreatic triacylglycerol lipase
NCBI Official Synonym Full Names
pancreatic lipase
NCBI Official Symbol
PNLIP
NCBI Official Synonym Symbols
PL; PTL; PNLIPD
NCBI Protein Information
pancreatic triacylglycerol lipase
UniProt Protein Name
Pancreatic triacylglycerol lipase
UniProt Gene Name
PNLIP
UniProt Synonym Gene Names
PL; PTL
UniProt Entry Name
LIPP_HUMAN

NCBI Description

This gene encodes a member of the lipase family of proteins. The encoded enzyme is secreted by the pancreas and hydrolyzes triglycerides in the small intestine, and is essential for the efficient digestion of dietary fats. Inhibition of the encoded enzyme may prevent high-fat diet-induced obesity in mice and result in weight loss in human patients with obesity. Mutations in this gene cause congenital pancreatic lipase deficiency, a rare disorder characterized by steatorrhea. [provided by RefSeq, Jul 2016]

Uniprot Description

PNLIP: a member of the lipase gene family. It encodes a carboxyl esterase that hydrolyzes insoluble, emulsified triglycerides, and is essential for the efficient digestion of dietary fats. expressed specifically in the pancreas. [provided by RefSeq, Jul 2008]

Protein type: EC 3.1.1.3; Lipid Metabolism - glycerolipid; Secreted; Secreted, signal peptide; Hydrolase

Chromosomal Location of Human Ortholog: 10q26.1

Cellular Component: extracellular region

Molecular Function: triacylglycerol lipase activity; metal ion binding

Biological Process: phototransduction, visible light; cholesterol absorption; retinoid metabolic process; lipid catabolic process; lipid digestion

Disease: Pancreatic Lipase Deficiency

Research Articles on PNLIP

Similar Products

Product Notes

The PNLIP pnlip (Catalog #AAA3201751) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PNLIP antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's PNLIP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PNLIP pnlip for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SGKKVTGHIL VSLFGNKGNS KQYEIFKGTL KPDSTHSNEF DSDVDVGDLQ. It is sometimes possible for the material contained within the vial of "PNLIP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.