Western Blot (WB)
(PLUNC antibody (MBS5302329) used at 0.25 ug/ml to detect target protein.)
Rabbit PLUNC Polyclonal Antibody | anti-PLUNC antibody
PLUNC antibody
Applications
Western Blot
Purity
Affinity purified
Synonyms
PLUNC; Polyclonal Antibody; PLUNC antibody; Polyclonal PLUNC; Anti-PLUNC; SPLUNC1; Palate Lung And Nasal Epithelium Carcinoma Associated; LUNX; SPURT; NASG; bA49G10.5; anti-PLUNC antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
PLUNC antibody was raised against the middle region of PLUNC
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLUNC antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
256
Applicable Applications for anti-PLUNC antibody
Western Blot (WB)
Application Notes
WB: 0.25 ug/ml
Biological Significance
PLUNC is the human homolog of murine plunc and is specifically expressed in the upper airways and nasopharyngeal regions. The exact biological function of this protein is not known, however, it has been suggested to be involved in inflammatory responses to irritants in the upper airways. It may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer.
Cross-Reactivity
Human, Mouse, Rat, Dog
Immunogen
PLUNC antibody was raised using the middle region of PLUNC corresponding to a region with amino acids GLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(PLUNC antibody (MBS5302329) used at 0.25 ug/ml to detect target protein.)
Western Blot (WB)
(PLUNC antibody (MBS5302329) used at 0.25 ug/ml to detect target protein.)
Related Product Information for anti-PLUNC antibody
Rabbit polyclonal PLUNC antibody raised against the middle region of PLUNC
Product Categories/Family for anti-PLUNC antibody
NCBI and Uniprot Product Information
NCBI GI #
Molecular Weight
28 kDa (MW of target protein)
NCBI Official Full Name
PLUNC
UniProt Protein Name
BPI fold-containing family A member 1
UniProt Gene Name
BPIFA1
UniProt Synonym Gene Names
LUNX; NASG; PLUNC; SPLUNC1; SPURT; SPLUNC1
UniProt Entry Name
BPIA1_HUMAN
Uniprot Description
PLUNC: May be involved in the airway inflammatory response after exposure to irritants. May be associated with tumor progression. May play a role in innate immune responses of the upper airways. Belongs to the BPI/LBP/Plunc superfamily. Plunc family.
Protein type: Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 20q11.2
Cellular Component: extracellular space; extracellular region
Molecular Function: lipid binding
Biological Process: antibacterial humoral response; innate immune response; regulation of liquid surface tension; multicellular organismal water homeostasis
Similar Products
Product Notes
The PLUNC bpifa1 (Catalog #AAA5302329) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's PLUNC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.25 ug/ml. Researchers should empirically determine the suitability of the PLUNC bpifa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PLUNC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
