Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using PLCL1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Rabbit anti-Mouse, Rat PLCL1 Polyclonal Antibody | anti-PLCL1 antibody
PLCL1 Polyclonal Antibody
Gene Names
PLCL1; PLCE; PLCL; PRIP; PLDL1; PPP1R127
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
PLCL1; Polyclonal Antibody; PLCL1 Polyclonal Antibody; PLCE; PLCL; PLDL1; PPP1R127; PRIP; anti-PLCL1 antibody
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
DCISFMQAGCELKKVRPNSRIYNRFFTLDTDLQALRWEPSKKDLEKAKLDISAIKEIRLGKNTETFRNNGLADQICEDCAFSILHGENYESLDLVANSADVANIWVSGLRYLVSRSKQPLDFMEGNQNTPRFMWLKTVFEAADVDGNGIMLEDTSVELIKQLNPTLKEAKIRLKFKEIQKSKEKLTTRVTEEEFCEAFCELCTRPEVYFLLVQISKNKEYLDANDLMLFLEAEQGVTHITE
Sequence Length
1095
Applicable Applications for anti-PLCL1 antibody
Western Blot (WB)
Application Notes
WB: 1:200 - 1:2000
Immunogen
Recombinant protein of human PLCL1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm
Positive Samples
Mouse brain, Mouse heart, Mouse kidney, Mouse lung
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using PLCL1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using PLCL1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Product Categories/Family for anti-PLCL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 113kDa; 122kDa
Observed: 140kDa
Observed: 140kDa
NCBI Official Full Name
inactive phospholipase C-like protein 1
NCBI Official Synonym Full Names
phospholipase C like 1 (inactive)
NCBI Official Symbol
PLCL1
NCBI Official Synonym Symbols
PLCE; PLCL; PRIP; PLDL1; PPP1R127
NCBI Protein Information
inactive phospholipase C-like protein 1
UniProt Protein Name
Inactive phospholipase C-like protein 1
Protein Family
UniProt Gene Name
PLCL1
UniProt Synonym Gene Names
PLC-L1; PRIP
Uniprot Description
Involved in an inositol phospholipid-based intracellular signaling cascade. Shows no PLC activity to phosphatidylinositol 4,5-bisphosphate and phosphatidylinositol. Component in the phospho-dependent endocytosis process of GABA A receptor (). Regulates the turnover of receptors and thus contributes to the maintenance of GABA-mediated synaptic inhibition. Its aberrant expression could contribute to the genesis and progression of lung carcinoma. Acts as an inhibitor of PPP1C.
Research Articles on PLCL1
1. susceptibility gene for dermatomyositis in Chinese patients with idiopathic inflammatory myopathies
Similar Products
Product Notes
The PLCL1 plcl1 (Catalog #AAA9135288) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLCL1 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PLCL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:200 - 1:2000. Researchers should empirically determine the suitability of the PLCL1 plcl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DCISFMQAGC ELKKVRPNSR IYNRFFTLDT DLQALRWEPS KKDLEKAKLD ISAIKEIRLG KNTETFRNNG LADQICEDCA FSILHGENYE SLDLVANSAD VANIWVSGLR YLVSRSKQPL DFMEGNQNTP RFMWLKTVFE AADVDGNGIM LEDTSVELIK QLNPTLKEAK IRLKFKEIQK SKEKLTTRVT EEEFCEAFCE LCTRPEVYFL LVQISKNKEY LDANDLMLFL EAEQGVTHIT E. It is sometimes possible for the material contained within the vial of "PLCL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
