Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PLPL9Sample Tissue: HT1080 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human PLA2G6 Polyclonal Antibody | anti-PLA2G6 antibody

PLA2G6 Antibody - middle region

Gene Names
PLA2G6; GVI; PLA2; INAD1; NBIA2; iPLA2; NBIA2A; NBIA2B; PARK14; PNPLA9; CaI-PLA2; IPLA2-VIA; iPLA2beta
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PLA2G6; Polyclonal Antibody; PLA2G6 Antibody - middle region; anti-PLA2G6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LFDWVAGTSTGGILALAILHSKSMAYMRGMYFRMKDEVFRGSRPYESGPL
Sequence Length
806
Applicable Applications for anti-PLA2G6 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PLPL9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PLPL9Sample Tissue: HT1080 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PLPL9Sample Tissue: HT1080 Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-PLA2G6 antibody
The protein encoded by this gene is an A2 phospholipase, a class of enzyme that catalyzes the release of fatty acids from phospholipids. The encoded protein may play a role in phospholipid remodelling, arachidonic acid release, leukotriene and prostaglandin synthesis, fas-mediated apoptosis, and transmembrane ion flux in glucose-stimulated B-cells. Several transcript variants encoding multiple isoforms have been described, but the full-length nature of only three of them have been determined to date.
Product Categories/Family for anti-PLA2G6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88 kDa
NCBI Official Full Name
85/88 kDa calcium-independent phospholipase A2 isoform a
NCBI Official Synonym Full Names
phospholipase A2 group VI
NCBI Official Symbol
PLA2G6
NCBI Official Synonym Symbols
GVI; PLA2; INAD1; NBIA2; iPLA2; NBIA2A; NBIA2B; PARK14; PNPLA9; CaI-PLA2; IPLA2-VIA; iPLA2beta
NCBI Protein Information
85/88 kDa calcium-independent phospholipase A2
UniProt Protein Name
85/88 kDa calcium-independent phospholipase A2
UniProt Gene Name
PLA2G6
UniProt Synonym Gene Names
PLPLA9; CaI-PLA2; GVI PLA2; iPLA2-beta; PNPLA9
UniProt Entry Name
PLPL9_HUMAN

NCBI Description

The protein encoded by this gene is an A2 phospholipase, a class of enzyme that catalyzes the release of fatty acids from phospholipids. The encoded protein may play a role in phospholipid remodelling, arachidonic acid release, leukotriene and prostaglandin synthesis, fas-mediated apoptosis, and transmembrane ion flux in glucose-stimulated B-cells. Several transcript variants encoding multiple isoforms have been described, but the full-length nature of only three of them have been determined to date. [provided by RefSeq, Dec 2010]

Uniprot Description

PLA2G6: Catalyzes the release of fatty acids from phospholipids. It has been implicated in normal phospholipid remodeling, nitric oxide-induced or vasopressin-induced arachidonic acid release and in leukotriene and prostaglandin production. May participate in fas mediated apoptosis and in regulating transmembrane ion flux in glucose-stimulated B-cells. Has a role in cardiolipin (CL) deacylation. Required for both speed and directionality of monocyte MCP1/CCL2-induced chemotaxis through regulation of F- actin polymerization at the pseudopods. Defects in PLA2G6 are the cause of neurodegeneration with brain iron accumulation type 2B (NBIA2B). A neurodegenerative disorder associated with iron accumulation in the brain, primarily in the basal ganglia. It is characterized by progressive extrapyramidal dysfunction leading to rigidity, dystonia, dysarthria and sensorimotor impairment. Defects in PLA2G6 are the cause of neurodegeneration with brain iron accumulation type 2A (NBIA2A); also known as Seitelberger disease. NBIA2A is a neurodegenerative disease characterized by pathologic axonal swelling and spheroid bodies in the central nervous system. Onset is within the first 2 years of life with death by age 10 years. Defects in PLA2G6 are the cause of Parkinson disease type 14 (PARK14). An adult-onset progressive neurodegenerative disorder characterized by parkinsonism, dystonia, severe cognitive decline, cerebral and cerebellar atrophy and absent iron in the basal ganglia on magnetic resonance imaging. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Lipid Metabolism - linoleic acid; Phospholipase; Lipid Metabolism - glycerophospholipid; Lipid Metabolism - alpha-linolenic acid; EC 3.1.1.4; Lipid Metabolism - ether lipid; Lipid Metabolism - arachidonic acid

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: membrane; mitochondrion; cytoplasm; microtubule organizing center; cytosol

Molecular Function: calmodulin binding; phospholipase A2 activity; ATP-dependent protein binding; calcium-independent phospholipase A2 activity

Biological Process: urinary bladder smooth muscle contraction; cardiolipin biosynthetic process; maternal process involved in pregnancy; glycerophospholipid biosynthetic process; negative regulation of synaptic transmission, glutamatergic; chemotaxis; positive regulation of vasodilation; memory; elevation of cytosolic calcium ion concentration; phospholipid metabolic process; innate immune response; positive regulation of protein amino acid phosphorylation; lipid catabolic process; positive regulation of exocytosis

Disease: Parkinson Disease 14, Autosomal Recessive; Neurodegeneration With Brain Iron Accumulation 2b; Neurodegeneration With Brain Iron Accumulation 2a

Research Articles on PLA2G6

Similar Products

Product Notes

The PLA2G6 pla2g6 (Catalog #AAA3219954) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLA2G6 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLA2G6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PLA2G6 pla2g6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LFDWVAGTST GGILALAILH SKSMAYMRGM YFRMKDEVFR GSRPYESGPL. It is sometimes possible for the material contained within the vial of "PLA2G6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.