Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PLA2G4ASample Tissue: Human PC-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human PLA2G4A Polyclonal Antibody | anti-PLA2G4A antibody

PLA2G4A Antibody - middle region

Gene Names
PLA2G4A; cPLA2; PLA2G4; cPLA2-alpha
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PLA2G4A; Polyclonal Antibody; PLA2G4A Antibody - middle region; anti-PLA2G4A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NRVLGVSGSQSRGSTMEEELENITTKHIVSNDSSDSDDESHEPKGTENED
Sequence Length
749
Applicable Applications for anti-PLA2G4A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PLA2G4A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PLA2G4ASample Tissue: Human PC-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PLA2G4ASample Tissue: Human PC-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PLA2G4A antibody
This gene encodes a member of the cytosolic phospholipase A2 group IV family. The enzyme catalyzes the hydrolysis of membrane phospholipids to release arachidonic acid which is subsequently metabolized into eicosanoids. Eicosanoids, including prostaglandins and leukotrienes, are lipid-based cellular hormones that regulate hemodynamics, inflammatory responses, and other intracellular pathways. The hydrolysis reaction also produces lysophospholipids that are converted into platelet-activating factor. The enzyme is activated by increased intracellular Ca(2+) levels and phosphorylation, resulting in its translocation from the cytosol and nucleus to perinuclear membrane vesicles. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-PLA2G4A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82 kDa
NCBI Official Full Name
cytosolic phospholipase A2 isoform 2
NCBI Official Synonym Full Names
phospholipase A2 group IVA
NCBI Official Symbol
PLA2G4A
NCBI Official Synonym Symbols
cPLA2; PLA2G4; cPLA2-alpha
NCBI Protein Information
cytosolic phospholipase A2
UniProt Protein Name
Cytosolic phospholipase A2
Protein Family
UniProt Gene Name
PLA2G4A
UniProt Synonym Gene Names
CPLA2; PLA2G4; cPLA2
UniProt Entry Name
PA24A_HUMAN

NCBI Description

This gene encodes a member of the cytosolic phospholipase A2 group IV family. The enzyme catalyzes the hydrolysis of membrane phospholipids to release arachidonic acid which is subsequently metabolized into eicosanoids. Eicosanoids, including prostaglandins and leukotrienes, are lipid-based cellular hormones that regulate hemodynamics, inflammatory responses, and other intracellular pathways. The hydrolysis reaction also produces lysophospholipids that are converted into platelet-activating factor. The enzyme is activated by increased intracellular Ca(2+) levels and phosphorylation, resulting in its translocation from the cytosol and nucleus to perinuclear membrane vesicles. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015]

Uniprot Description

cPLA2: a calcium-dependent phospholipase A2 that catalyzes the release of arachidonic acid from membrane phospholipids. Selectively hydrolyzes arachidonyl phospholipids in the sn-2 position releasing arachidonic acid. Arachidonic acid is a precursor for the eicosanoids that are involved in hemodynamic regulation, inflammatory responses, and other cellular processes. Promotes cerebellar long-term depression and motor learning. Translocates to the Golgi and endoplasmic reticulum in a calcium-dependent fashion. Translocation and activation of at the ER facilitates the process of ER stress. Regulates the biogenesis of lipid droplets, a process dependent on JNK and ceramide kinase. Stimulated by agonists such as ATP, EGF, thrombin and bradykinin as well as by cytosolic Ca2+. The N-terminal C2 domain, by its association with lipid membranes, mediates the regulation of CPLA2 by presenting the active site to its substrate in response to elevations of cytosolic Ca2+. Inhibited when in trimolecular complex with ANXA2 and S100A10. Phosphorylation of S727 relieves this inhibitory interaction, thus activating PLA2G4A.

Protein type: Lipid Metabolism - ether lipid; EC 3.1.1.4; Lipid Metabolism - glycerophospholipid; Lipid Metabolism - arachidonic acid; EC 3.1.1.5; Phospholipase; Lipid Metabolism - linoleic acid; Lipid Metabolism - alpha-linolenic acid

Chromosomal Location of Human Ortholog: 1q25

Cellular Component: Golgi apparatus; endoplasmic reticulum membrane; cytoplasm; cytoplasmic membrane-bound vesicle; mitochondrial inner membrane; cytosol

Molecular Function: phospholipase A2 activity; calcium-dependent phospholipase A2 activity; calcium-dependent phospholipid binding; calcium ion binding; lysophospholipase activity

Biological Process: icosanoid biosynthetic process; platelet activating factor biosynthetic process; platelet activation; phospholipid catabolic process; phospholipid metabolic process; glycerophospholipid biosynthetic process; icosanoid metabolic process; phosphatidic acid biosynthetic process; arachidonic acid metabolic process; arachidonic acid secretion; blood coagulation; regulation of cell proliferation

Research Articles on PLA2G4A

Similar Products

Product Notes

The PLA2G4A pla2g4a (Catalog #AAA3223105) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PLA2G4A Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PLA2G4A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PLA2G4A pla2g4a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NRVLGVSGSQ SRGSTMEEEL ENITTKHIVS NDSSDSDDES HEPKGTENED. It is sometimes possible for the material contained within the vial of "PLA2G4A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.