Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-PKLR AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit PKLR Polyclonal Antibody | anti-PKLR antibody

PKLR antibody - N-terminal region

Gene Names
PKLR; PK1; PKL; RPK; PKRL
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
PKLR; Polyclonal Antibody; PKLR antibody - N-terminal region; anti-PKLR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: STSIIATIGPASRSVERLKEMIKAGMNIARLNFSHGSHEYHAESIANVRE
Sequence Length
543
Applicable Applications for anti-PKLR antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PKLR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-PKLR AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-PKLR AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(PKLR antibody - N-terminal region validated by WB using HepG2 cell lysate at 1.0ug/ml.There is BioGPS gene expression data showing that PKLR is expressed in HepG2)

Western Blot (WB) (PKLR antibody - N-terminal region validated by WB using HepG2 cell lysate at 1.0ug/ml.There is BioGPS gene expression data showing that PKLR is expressed in HepG2)
Related Product Information for anti-PKLR antibody
This is a rabbit polyclonal antibody against PKLR. It was validated on Western Blot and immunohistochemistry

Target Description: PKLR is a pyruvate kinase that catalyzes the production of phohsphoenolpyruvate from pyruvate and ATP. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA).The protein encoded by this gene is a pyruvate kinase that catalyzes the production of phohsphoenolpyruvate from pyruvate and ATP. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Alternatively spliced transcript variants encoding distinct isoforms have been described.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
pyruvate kinase PKLR isoform 2
NCBI Official Synonym Full Names
pyruvate kinase L/R
NCBI Official Symbol
PKLR
NCBI Official Synonym Symbols
PK1; PKL; RPK; PKRL
NCBI Protein Information
pyruvate kinase PKLR
UniProt Protein Name
Pyruvate kinase PKLR
Protein Family
UniProt Gene Name
PKLR
UniProt Synonym Gene Names
PK1; PKL
UniProt Entry Name
KPYR_HUMAN

NCBI Description

The protein encoded by this gene is a pyruvate kinase that catalyzes the transphosphorylation of phohsphoenolpyruvate into pyruvate and ATP, which is the rate-limiting step of glycolysis. Defects in this enzyme, due to gene mutations or genetic variations, are the common cause of chronic hereditary nonspherocytic hemolytic anemia (CNSHA or HNSHA). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

PKLR: one of three rate-limiting enzymes in glycolysis. It catalyzes the transfer of a phosphate group from phosphoenolpyruvate (PEP) to ADP, yielding one molecule ATP and a pyruvate molecule, which is a central metabolic intermediate that can be used as a building block or oxidized further. There are several mammalian isozymes of pyruvate kinase encoded by different genes. The L type predominates in liver, and the M type in muscle and brain. Two alternatively spliced human isoforms have been described: the R- and L-types.

Protein type: Carbohydrate Metabolism - pyruvate; Carbohydrate Metabolism - glycolysis and gluconeogenesis; Kinase, other; Nucleotide Metabolism - purine; EC 2.7.1.40

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: cytosol

Molecular Function: potassium ion binding; magnesium ion binding; pyruvate kinase activity; ATP binding

Biological Process: pyruvate biosynthetic process; glycolysis; response to cAMP; response to lithium ion; positive regulation of cellular metabolic process; glucose metabolic process; pathogenesis; response to other organism; endocrine pancreas development; response to ATP; cellular response to insulin stimulus; response to heat; ATP biosynthetic process; carbohydrate metabolic process; response to hypoxia; energy reserve metabolic process; response to glucose stimulus; phosphorylation; response to nutrient

Disease: Adenosine Triphosphate, Elevated, Of Erythrocytes; Pyruvate Kinase Deficiency Of Red Cells

Research Articles on PKLR

Similar Products

Product Notes

The PKLR pklr (Catalog #AAA3205987) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PKLR antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PKLR can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the PKLR pklr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: STSIIATIGP ASRSVERLKE MIKAGMNIAR LNFSHGSHEY HAESIANVRE. It is sometimes possible for the material contained within the vial of "PKLR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.