Testing Data
(Detection limit for recombinant GST tagged FIBP is 10ng/ml as a capture antibody.)
Mouse anti-Human FIBP Monoclonal Antibody | anti-FIBP antibody
FIBP (Acidic Fibroblast Growth Factor Intracellular-binding Protein, FGF-1 Intracellular-binding Protein) APC
Gene Names
FIBP; FGFIBP; FIBP-1
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FIBP; Monoclonal Antibody; FIBP (Acidic Fibroblast Growth Factor Intracellular-binding Protein; FGF-1 Intracellular-binding Protein) APC; anti-FIBP antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1E5
Specificity
Recognizes human FIBP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-FIBP antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-358 from FIBP (AAH14388) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVGDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged FIBP is 10ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged FIBP is 10ng/ml as a capture antibody.)
Related Product Information for anti-FIBP antibody
Acidic fibroblast growth factor is mitogenic for a variety of different cell types and acts by stimulating mitogenesis or inducing morphological changes and differentiation. The FIBP protein is an intracellular protein that binds selectively to acidic fibroblast growth factor (aFGF). It is postulated that FIBP may be involved in the mitogenic action of aFGF. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-FIBP antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
41,210 Da
NCBI Official Full Name
Homo sapiens fibroblast growth factor (acidic) intracellular binding protein, mRNA
NCBI Official Synonym Full Names
FGF1 intracellular binding protein
NCBI Official Symbol
FIBP
NCBI Official Synonym Symbols
FGFIBP; FIBP-1
NCBI Protein Information
acidic fibroblast growth factor intracellular-binding protein
NCBI Description
Acidic fibroblast growth factor is mitogenic for a variety of different cell types and acts by stimulating mitogenesis or inducing morphological changes and differentiation. The FIBP protein is an intracellular protein that binds selectively to acidic fibroblast growth factor (aFGF). It is postulated that FIBP may be involved in the mitogenic action of aFGF. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Research Articles on FIBP
Similar Products
Product Notes
The FIBP (Catalog #AAA6136605) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FIBP (Acidic Fibroblast Growth Factor Intracellular-binding Protein, FGF-1 Intracellular-binding Protein) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FIBP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FIBP for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FIBP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
