Western Blot (WB)
(WB Suggested Anti-Pitpnc1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Small Intestine)
Rabbit Pitpnc1 Polyclonal Antibody | anti-PITPNC1 antibody
Pitpnc1 antibody - middle region
Gene Names
Pitpnc1; RDGBB; Dnr411; RDGBB1; AI662802; AI851387; mrdgBbeta; rdgB-beta; 1110020B03Rik; 5830436L09Rik; C330017I21Rik
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Pitpnc1; Polyclonal Antibody; Pitpnc1 antibody - middle region; anti-PITPNC1 antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FLPKFSIHIETKYEDNKGSNDSIFDSEAKDLEREVCFIDIACDEIPERYY
Sequence Length
268
Applicable Applications for anti-PITPNC1 antibody
Western Blot (WB)
Homology
Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Pitpnc1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Small Intestine)
Western Blot (WB)
(WB Suggested Anti-Pitpnc1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Small Intestine)
Related Product Information for anti-PITPNC1 antibody
This is a rabbit polyclonal antibody against Pitpnc1. It was validated on Western Blot
Target Description: Phosphatidylinositol transfer proteins mediate the monomeric transport of lipids by shielding a lipid from the aqueous environment and binding the lipid in a hydrophobic cavity. Able to transfer phosphatidylinositol in vitro. Isoform 2 specifically binds to phosphatidylinositol but not to other phospholipids and may play a role in the phosphoinositide-mediated signaling in the neural development.
Target Description: Phosphatidylinositol transfer proteins mediate the monomeric transport of lipids by shielding a lipid from the aqueous environment and binding the lipid in a hydrophobic cavity. Able to transfer phosphatidylinositol in vitro. Isoform 2 specifically binds to phosphatidylinositol but not to other phospholipids and may play a role in the phosphoinositide-mediated signaling in the neural development.
Product Categories/Family for anti-PITPNC1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
cytoplasmic phosphatidylinositol transfer protein 1 isoform 2
NCBI Official Synonym Full Names
phosphatidylinositol transfer protein, cytoplasmic 1
NCBI Official Symbol
Pitpnc1
NCBI Official Synonym Symbols
RDGBB; Dnr411; RDGBB1; AI662802; AI851387; mrdgBbeta; rdgB-beta; 1110020B03Rik; 5830436L09Rik; C330017I21Rik
NCBI Protein Information
cytoplasmic phosphatidylinositol transfer protein 1
UniProt Protein Name
Cytoplasmic phosphatidylinositol transfer protein 1
Protein Family
UniProt Gene Name
Pitpnc1
UniProt Synonym Gene Names
M-rdgB beta; MrdgBbeta; mM-rdgBbeta; RdgBbeta
UniProt Entry Name
PITC1_MOUSE
Similar Products
Product Notes
The PITPNC1 pitpnc1 (Catalog #AAA3215590) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Pitpnc1 antibody - middle region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Pitpnc1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PITPNC1 pitpnc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FLPKFSIHIE TKYEDNKGSN DSIFDSEAKD LEREVCFIDI ACDEIPERYY. It is sometimes possible for the material contained within the vial of "Pitpnc1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
