Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Tbce AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)

Rabbit Tbce Polyclonal Antibody | anti-TBCE antibody

Tbce antibody - N-terminal region

Gene Names
Tbce; pmn; 2610206D02Rik; C530005D02Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Tbce; Polyclonal Antibody; Tbce antibody - N-terminal region; anti-TBCE antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLWLGVEWDNPERGKHDGSHEGTMYFKCRHPTGGSFVRPSKVNFGDDFLT
Sequence Length
524
Applicable Applications for anti-TBCE antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 92%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Tbce AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)

Western Blot (WB) (WB Suggested Anti-Tbce AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Liver)
Related Product Information for anti-TBCE antibody
This is a rabbit polyclonal antibody against Tbce. It was validated on Western Blot

Target Description: Tbce is a rubulin-folding protein; it is involved in the second step of the tubulin folding pathway. Tbce seems to be implicated in the maintenance of the neuronal microtubule network. Tbce is involved in regulation of tubulin heterodimer dissociation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
tubulin-specific chaperone E
NCBI Official Synonym Full Names
tubulin-specific chaperone E
NCBI Official Symbol
Tbce
NCBI Official Synonym Symbols
pmn; 2610206D02Rik; C530005D02Rik
NCBI Protein Information
tubulin-specific chaperone E
UniProt Protein Name
Tubulin-specific chaperone E
UniProt Gene Name
Tbce
UniProt Entry Name
TBCE_MOUSE

NCBI Description

This gene encodes a tubulin binding cofactor that participates in microtubule dynamics. A mouse model of progressive motor neuropathy (pmn) was discovered to harbor a single amino acid deletion in this gene. Mice that are homozygous for pmn allele exhibit progressive atrophy and premature death due to respiratory failure. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Feb 2015]

Uniprot Description

TBCE: Tubulin-folding protein; involved in the second step of the tubulin folding pathway. Seems to be implicated in the maintenance of the neuronal microtubule network. Involved in regulation of tubulin heterodimer dissociation. Defects in TBCE are a cause of hypoparathyroidism- retardation-dysmorphism syndrome (HRD); also known as hypoparathyroidism with short stature, mental retardation, and seizures or Sanjad-Sakati syndrome. HRD is an autosomal recessive disorder reported almost exclusively in Middle Eastern populations. Defects in TBCE are the cause of Kenny-Caffey syndrome type 1 (KCS1). KCS1 is similar to HRD with the additional features of osteosclerosis and recurrent bacterial infections. Belongs to the TBCE family.

Protein type: Chaperone

Cellular Component: cytoskeleton; cytoplasm

Molecular Function: unfolded protein binding

Biological Process: tubulin folding; developmental growth; protein folding; axonogenesis; adult locomotory behavior; muscle atrophy; microtubule cytoskeleton organization and biogenesis; post-chaperonin tubulin folding pathway; peripheral nervous system neuron axonogenesis; post-embryonic development

Research Articles on TBCE

Similar Products

Product Notes

The TBCE tbce (Catalog #AAA3215329) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Tbce antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Tbce can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TBCE tbce for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLWLGVEWDN PERGKHDGSH EGTMYFKCRH PTGGSFVRPS KVNFGDDFLT. It is sometimes possible for the material contained within the vial of "Tbce, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.