Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GDAP1 AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole Cell)

Rabbit GDAP1 Polyclonal Antibody | anti-GDAP1 antibody

GDAP1 antibody - C-terminal region

Gene Names
GDAP1; CMT4; CMT4A; CMTRIA
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GDAP1; Polyclonal Antibody; GDAP1 antibody - C-terminal region; anti-GDAP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ETELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWG
Sequence Length
290
Applicable Applications for anti-GDAP1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 87%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GDAP1 AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole Cell)

Western Blot (WB) (WB Suggested Anti-GDAP1 AntibodyTitration: 1.0 ug/mlPositive Control: OVCAR-3 Whole Cell)
Related Product Information for anti-GDAP1 antibody
This is a rabbit polyclonal antibody against GDAP1. It was validated on Western Blot

Target Description: This gene encodes a member of the ganglioside-induced differentiation-associated protein family, which may play a role in a signal transduction pathway during neuronal development. Mutations in this gene have been associated with various forms of Charcot-Marie-Tooth Disease and neuropathy. Two transcript variants encoding different isoforms have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
ganglioside-induced differentiation-associated protein 1 isoform b
NCBI Official Synonym Full Names
ganglioside induced differentiation associated protein 1
NCBI Official Symbol
GDAP1
NCBI Official Synonym Symbols
CMT4; CMT4A; CMTRIA
NCBI Protein Information
ganglioside-induced differentiation-associated protein 1
UniProt Protein Name
Ganglioside-induced differentiation-associated protein 1
UniProt Gene Name
GDAP1
UniProt Synonym Gene Names
GDAP1
UniProt Entry Name
GDAP1_HUMAN

NCBI Description

This gene encodes a member of the ganglioside-induced differentiation-associated protein family, which may play a role in a signal transduction pathway during neuronal development. Mutations in this gene have been associated with various forms of Charcot-Marie-Tooth Disease and neuropathy. Two transcript variants encoding different isoforms and a noncoding variant have been identified for this gene. [provided by RefSeq, Feb 2012]

Research Articles on GDAP1

Similar Products

Product Notes

The GDAP1 gdap1 (Catalog #AAA3216211) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GDAP1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GDAP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GDAP1 gdap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ETELQRRNEE TPEEGQQPWL CGESFTLADV SLAVTLHRLK FLGFARRNWG. It is sometimes possible for the material contained within the vial of "GDAP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.