Western Blot (WB)
(WB Suggested Anti-PISD AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Rabbit PISD Polyclonal Antibody | anti-PISD antibody
PISD Antibody - C-terminal region
Gene Names
PISD; PSD; PSDC; PSSC; DJ858B16; dJ858B16.2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PISD; Polyclonal Antibody; PISD Antibody - C-terminal region; anti-PISD antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MCTEDLPFPPAASCDSFKNQLVTREGNELYHCVIYLAPGDYHCFHSPTDW
Sequence Length
375
Applicable Applications for anti-PISD antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 92%; Guinea Pig: 86%; Horse: 92%; Human: 100%; Mouse: 93%; Rabbit: 79%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PISD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-PISD AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Western Blot (WB)
(WB Suggested Anti-PISD AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Brain)
Related Product Information for anti-PISD antibody
This is a rabbit polyclonal antibody against PISD. It was validated on Western Blot
Target Description: Phosphatidylserine decarboxylases catalyze the formation of phosphatidylethanolamine (PE) by decarboxylation of phosphatidylserine (PS). Type I PSDs, such as PISD, are targeted to the inner mitochondrial membrane by an N-terminal targeting sequence. PISD also contains a conserved LGST motif that functions as an autocatalytic cleavage site where the proenzyme is split into mature alpha and beta subunits.
Target Description: Phosphatidylserine decarboxylases catalyze the formation of phosphatidylethanolamine (PE) by decarboxylation of phosphatidylserine (PS). Type I PSDs, such as PISD, are targeted to the inner mitochondrial membrane by an N-terminal targeting sequence. PISD also contains a conserved LGST motif that functions as an autocatalytic cleavage site where the proenzyme is split into mature alpha and beta subunits.
Product Categories/Family for anti-PISD antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
phosphatidylserine decarboxylase proenzyme, mitochondrial isoform d
NCBI Official Synonym Full Names
phosphatidylserine decarboxylase
NCBI Official Symbol
PISD
NCBI Official Synonym Symbols
PSD; PSDC; PSSC; DJ858B16; dJ858B16.2
NCBI Protein Information
phosphatidylserine decarboxylase proenzyme, mitochondrial
UniProt Protein Name
Phosphatidylserine decarboxylase proenzyme
UniProt Gene Name
PISD
UniProt Entry Name
PISD_HUMAN
NCBI Description
The protein encoded by this gene catalyzes the conversion of phosphatidylserine to phosphatidylethanolamine in the inner mitochondrial membrane. The encoded protein is active in phospholipid metabolism and interorganelle trafficking of phosphatidylserine. [provided by RefSeq, May 2016]
Uniprot Description
PISD: Belongs to the phosphatidylserine decarboxylase family. Heterodimer. 2 isoforms of the human protein are produced by alternative splicing
Protein type: Endoplasmic reticulum; Lipid Metabolism - glycerophospholipid; Lyase; EC 4.1.1.65
Chromosomal Location of Human Ortholog: 22q12.2
Cellular Component: mitochondrion; nucleus
Molecular Function: phosphatidylserine decarboxylase activity
Biological Process: phospholipid metabolic process; glycerophospholipid biosynthetic process; phosphatidylethanolamine biosynthetic process
Research Articles on PISD
Similar Products
Product Notes
The PISD pisd (Catalog #AAA3216868) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PISD Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PISD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PISD pisd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MCTEDLPFPP AASCDSFKNQ LVTREGNELY HCVIYLAPGD YHCFHSPTDW. It is sometimes possible for the material contained within the vial of "PISD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
