Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PIP4K2BSample Type: NCI-H226 Whole Cell lysatesAntibody Dilution: 1.0ug/mlPIP4K2B is strongly supported by BioGPS gene expression data to be expressed in NCI-H226)

Rabbit PIP4K2B Polyclonal Antibody | anti-PIP4K2B antibody

PIP4K2B Antibody - C-terminal region

Gene Names
PIP4K2B; PI5P4KB; PIP5K2B; PIP5KIIB; PIP5P4KB; PIP5KIIbeta
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PIP4K2B; Polyclonal Antibody; PIP4K2B Antibody - C-terminal region; anti-PIP4K2B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DVYAMKSHESSPKKEVYFMAIIDILTPYDTKKKAAHAAKTVKHGAGAEIS
Sequence Length
416
Applicable Applications for anti-PIP4K2B antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PIP4K2B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PIP4K2BSample Type: NCI-H226 Whole Cell lysatesAntibody Dilution: 1.0ug/mlPIP4K2B is strongly supported by BioGPS gene expression data to be expressed in NCI-H226)

Western Blot (WB) (Host: RabbitTarget Name: PIP4K2BSample Type: NCI-H226 Whole Cell lysatesAntibody Dilution: 1.0ug/mlPIP4K2B is strongly supported by BioGPS gene expression data to be expressed in NCI-H226)
Related Product Information for anti-PIP4K2B antibody
This is a rabbit polyclonal antibody against PIP4K2B. It was validated on Western Blot

Target Description: The protein encoded by this gene catalyzes the phosphorylation of phosphatidylinositol-5-phosphate on the fourth hydroxyl of the myo-inositol ring to form phosphatidylinositol-5,4-bisphosphate. This gene is a member of the phosphatidylinositol-5-phosphate 4-kinase family. The encoded protein sequence does not show similarity to other kinases, but the protein does exhibit kinase activity. Additionally, the encoded protein interacts with p55 TNF receptor.
Product Categories/Family for anti-PIP4K2B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
phosphatidylinositol 5-phosphate 4-kinase type-2 beta
NCBI Official Synonym Full Names
phosphatidylinositol-5-phosphate 4-kinase type 2 beta
NCBI Official Symbol
PIP4K2B
NCBI Official Synonym Symbols
PI5P4KB; PIP5K2B; PIP5KIIB; PIP5P4KB; PIP5KIIbeta
NCBI Protein Information
phosphatidylinositol 5-phosphate 4-kinase type-2 beta
UniProt Protein Name
Phosphatidylinositol 5-phosphate 4-kinase type-2 beta
UniProt Gene Name
PIP4K2B
UniProt Synonym Gene Names
PIP5K2B; PI(5)P 4-kinase type II beta; PIP4KII-beta
UniProt Entry Name
PI42B_HUMAN

NCBI Description

The protein encoded by this gene catalyzes the phosphorylation of phosphatidylinositol-5-phosphate on the fourth hydroxyl of the myo-inositol ring to form phosphatidylinositol-5,4-bisphosphate. This gene is a member of the phosphatidylinositol-5-phosphate 4-kinase family. The encoded protein sequence does not show similarity to other kinases, but the protein does exhibit kinase activity. Additionally, the encoded protein interacts with p55 TNF receptor. [provided by RefSeq, Jul 2008]

Uniprot Description

PIP4K2B: Participates in the biosynthesis of phosphatidylinositol 4,5-bisphosphate. Homodimer. Binds TNFRSF1A. Interacts with PIP4K2A. Interaction with PIP4K2A suppresses ubiquitination by the SPOP/ CUL3 complex. Highly expressed in brain, heart, pancreas, skeletal muscle and kidney. Detected at lower levels in placenta, lung and liver. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.7.1.149; Motility/polarity/chemotaxis; Carbohydrate Metabolism - inositol phosphate; Kinase, lipid

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: nucleoplasm; endoplasmic reticulum membrane; plasma membrane; cytosol

Molecular Function: 1-phosphatidylinositol-4-phosphate 5-kinase activity; receptor signaling protein activity; 1-phosphatidylinositol-5-phosphate 4-kinase activity; ATP binding

Biological Process: cell surface receptor linked signal transduction; phosphoinositide phosphorylation; phospholipid metabolic process; phosphatidylinositol biosynthetic process

Research Articles on PIP4K2B

Similar Products

Product Notes

The PIP4K2B pip4k2b (Catalog #AAA3218860) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PIP4K2B Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PIP4K2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PIP4K2B pip4k2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DVYAMKSHES SPKKEVYFMA IIDILTPYDT KKKAAHAAKT VKHGAGAEIS. It is sometimes possible for the material contained within the vial of "PIP4K2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.