Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-PINX1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit PINX1 Polyclonal Antibody | anti-PINX1 antibody

PINX1 antibody - middle region

Gene Names
PINX1; Gno1; LPTL; LPTS; Pxr1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
PINX1; Polyclonal Antibody; PINX1 antibody - middle region; anti-PINX1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSKTDLDCIFGKRQSKKTP
Sequence Length
328
Applicable Applications for anti-PINX1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PINX1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-PINX1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-PINX1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
Related Product Information for anti-PINX1 antibody
This is a rabbit polyclonal antibody against PINX1. It was validated on Western Blot

Target Description: PINX1 is a microtubule-binding protein essential for faithful chromosome segregation. PINX1 mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres. PINX1 inhibits telomerase activity and may inhibit cell proliferation and act as tumor suppressor.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
PIN2/TERF1-interacting telomerase inhibitor 1 isoform 1
NCBI Official Synonym Full Names
PIN2 (TERF1) interacting telomerase inhibitor 1
NCBI Official Symbol
PINX1
NCBI Official Synonym Symbols
Gno1; LPTL; LPTS; Pxr1
NCBI Protein Information
PIN2/TERF1-interacting telomerase inhibitor 1
UniProt Protein Name
PIN2/TERF1-interacting telomerase inhibitor 1
UniProt Gene Name
PINX1
UniProt Synonym Gene Names
LPTL; LPTS
UniProt Entry Name
PINX1_HUMAN

Uniprot Description

PINX1: Microtubule-binding protein essential for faithful chromosome segregation. Mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres. Inhibits telomerase activity. May inhibit cell proliferation and act as tumor suppressor. Belongs to the PINX1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Tumor suppressor; Inhibitor; Nucleolus

Chromosomal Location of Human Ortholog: 8p23

Cellular Component: nucleoplasm; kinetochore; nuclear chromosome; chromosome, telomeric region; mitochondrion; intracellular membrane-bound organelle; cytoplasm; nucleolus; spindle; nucleus

Molecular Function: protein binding

Biological Process: negative regulation of cell proliferation; negative regulation of telomerase activity; regulation of telomerase activity; telomere maintenance via telomerase; mitotic metaphase plate congression

Research Articles on PINX1

Similar Products

Product Notes

The PINX1 pinx1 (Catalog #AAA3213151) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PINX1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's PINX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PINX1 pinx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EKKSFSLEEK SKISKNRVHY MKFTKGKDLS SRSKTDLDCI FGKRQSKKTP. It is sometimes possible for the material contained within the vial of "PINX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.