Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human PIN1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 18 kDa.)

PIN1 active protein

Recombinant Human PIN1 Protein

Gene Names
PIN1; DOD; UBL5
Purity
>95% by SDS-PAGE.
Synonyms
PIN1; Recombinant Human PIN1 Protein; DOD; UBL5; PIN1 active protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Sequence Length
163
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Specific activity is > 330 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 umole of suc-AAFP-pNA per minute at 25 degree C in Tris-Hcl pH8.0 using chymotrypsin.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
No tag
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human PIN1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 18 kDa.)

SDS-Page (Recombinant Human PIN1 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 18 kDa.)
Related Product Information for PIN1 active protein
Description: Recombinant Human PIN1 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Glu163) of human PIN1 (Accession #NP_006212.1).

Background: Peptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This protein is a nucleus protein which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-phosphorylation conformation of its substrates. The conformational regulation catalyzed by this PPIase has a profound impact on key proteins involved in the regulation of cell growth, genotoxic and other stress responses, the immune response, induction and maintenance of pluripotency, germ cell development, neuronal differentiation, and survival. This enzyme also plays a key role in the pathogenesis of Alzheimer's disease and many cancers.
Product Categories/Family for PIN1 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
NCBI Official Synonym Full Names
peptidylprolyl cis/trans isomerase, NIMA-interacting 1
NCBI Official Symbol
PIN1
NCBI Official Synonym Symbols
DOD; UBL5
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
UniProt Gene Name
PIN1
UniProt Synonym Gene Names
PPIase Pin1
UniProt Entry Name
PIN1_HUMAN

NCBI Description

Peptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This gene encodes one of the PPIases, which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-phosphorylation conformation of its substrates. The conformational regulation catalyzed by this PPIase has a profound impact on key proteins involved in the regulation of cell growth, genotoxic and other stress responses, the immune response, induction and maintenance of pluripotency, germ cell development, neuronal differentiation, and survival. This enzyme also plays a key role in the pathogenesis of Alzheimer's disease and many cancers. Multiple alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Jun 2011]

Uniprot Description

PIN1: a member of the parvulin family of peptidyl-prolyl isomerases (PPIase), has been implicated in the G2-M transition of the cell cycle. Has two distinct functional domains: an N-terminal WW domain and a C-terminal PPlase domain. Pin1 interacts with a series of mitotic phosphoproteins, including Plk1, cdc25C and cdc27, catalyzing pSer-Pro or pThr/Pro cis/trans isomerizations. Displays a preference for an acidic residue n-terminal to the isomerized proline bond.

Protein type: Nuclear receptor co-regulator; EC 5.2.1.8; Isomerase

Chromosomal Location of Human Ortholog: 19p13

Cellular Component: nucleoplasm; cytoplasm; nuclear speck; midbody; nucleus

Molecular Function: protein binding; peptidyl-prolyl cis-trans isomerase activity; mitogen-activated protein kinase kinase binding; phosphothreonine binding; GTPase activating protein binding; phosphoserine binding

Biological Process: protein peptidyl-prolyl isomerization; positive regulation of ubiquitin-protein ligase activity; cytokine and chemokine mediated signaling pathway; regulation of mitosis; innate immune response; positive regulation of protein amino acid phosphorylation; cell cycle; negative regulation of transforming growth factor beta receptor signaling pathway; regulation of cytokinesis; negative regulation of interferon type I production

Research Articles on PIN1

Similar Products

Product Notes

The PIN1 pin1 (Catalog #AAA9139618) is an Active Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MADEEKLPPG WEKRMSRSSG RVYYFNHITN ASQWERPSGN SSSGGKNGQG EPARVRCSHL LVKHSQSRRP SSWRQEKITR TKEEALELIN GYIQKIKSGE EDFESLASQF SDCSSAKARG DLGAFSRGQM QKPFEDASFA LRTGEMSGPV FTDSGIHIIL RTE. It is sometimes possible for the material contained within the vial of "PIN1, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.