Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PIK3R2Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human PIK3R2 Polyclonal Antibody | anti-PIK3R2 antibody

PIK3R2 Antibody - N-terminal region

Gene Names
PIK3R2; p85; MPPH; P85B; MPPH1; p85-BETA
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PIK3R2; Polyclonal Antibody; PIK3R2 Antibody - N-terminal region; anti-PIK3R2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VALARPGPRPRGPRPLPARPRDGAPEPGLTLPDLPEQFSPPDVAPPLLVK
Sequence Length
728
Applicable Applications for anti-PIK3R2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human PIK3R2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PIK3R2Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PIK3R2Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PIK3R2 antibody
Phosphatidylinositol 3-kinase (PI3K) is a lipid kinase that phosphorylates phosphatidylinositol and similar compounds, creating second messengers important in growth signaling pathways. PI3K functions as a heterodimer of a regulatory and a catalytic subunit. The protein encoded by this gene is a regulatory component of PI3K. Two transcript variants, one protein coding and the other non-protein coding, have been found for this gene.
Product Categories/Family for anti-PIK3R2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80 kDa
NCBI Official Full Name
phosphatidylinositol 3-kinase regulatory subunit beta
NCBI Official Synonym Full Names
phosphoinositide-3-kinase regulatory subunit 2
NCBI Official Symbol
PIK3R2
NCBI Official Synonym Symbols
p85; MPPH; P85B; MPPH1; p85-BETA
NCBI Protein Information
phosphatidylinositol 3-kinase regulatory subunit beta
UniProt Protein Name
Phosphatidylinositol 3-kinase regulatory subunit beta
UniProt Gene Name
PIK3R2
UniProt Synonym Gene Names
PI3-kinase regulatory subunit beta; PI3K regulatory subunit beta; PtdIns-3-kinase regulatory subunit beta; PI3-kinase subunit p85-beta
UniProt Entry Name
P85B_HUMAN

NCBI Description

Phosphatidylinositol 3-kinase (PI3K) is a lipid kinase that phosphorylates phosphatidylinositol and similar compounds, creating second messengers important in growth signaling pathways. PI3K functions as a heterodimer of a regulatory and a catalytic subunit. The protein encoded by this gene is a regulatory component of PI3K. Two transcript variants, one protein coding and the other non-protein coding, have been found for this gene. [provided by RefSeq, Dec 2012]

Research Articles on PIK3R2

Similar Products

Product Notes

The PIK3R2 pik3r2 (Catalog #AAA3221275) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PIK3R2 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIK3R2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PIK3R2 pik3r2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VALARPGPRP RGPRPLPARP RDGAPEPGLT LPDLPEQFSP PDVAPPLLVK. It is sometimes possible for the material contained within the vial of "PIK3R2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.