Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- PIGR Picoband antibody, MBS178150, Western blottingAll lanes: Anti PIGR (MBS178150) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: SKOV Whole Cell Lysate at 40ugLane 3: MCF-7 Whole Cell Lysate at 40ugLane 4: SW620 Whole Cell Lysate at 40ugPredicted bind size: 83KDObserved bind size: 83KD )

anti-Human PIGR Polyclonal Antibody | anti-PIGR antibody

Anti-PIGR Antibody

Reactivity
Human
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
PIGR; Polyclonal Antibody; Anti-PIGR Antibody; Polymeric immunoglobulin receptor; Hepatocellular carcinoma associated protein TB6; Hepatocellular carcinoma-associated protein TB6; MGC125361; MGC125362; Phosphatidylinositol glycan; class R; PIGR_HUMAN; Poly Ig receptor; Poly-Ig receptor; Secretory component; Transmembrane secretory component; polymeric immunoglobulin receptor; anti-PIGR antibody
Ordering
For Research Use Only!
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
764
Applicable Applications for anti-PIGR antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human PIGR (579-613aa DAAPDEKVLDSGFREIENKAIQDPRLFAEEKAVAD), different from the related rat sequence by eighteen amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- PIGR Picoband antibody, MBS178150, Western blottingAll lanes: Anti PIGR (MBS178150) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: SKOV Whole Cell Lysate at 40ugLane 3: MCF-7 Whole Cell Lysate at 40ugLane 4: SW620 Whole Cell Lysate at 40ugPredicted bind size: 83KDObserved bind size: 83KD )

Western Blot (WB) (Anti- PIGR Picoband antibody, MBS178150, Western blottingAll lanes: Anti PIGR (MBS178150) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: SKOV Whole Cell Lysate at 40ugLane 3: MCF-7 Whole Cell Lysate at 40ugLane 4: SW620 Whole Cell Lysate at 40ugPredicted bind size: 83KDObserved bind size: 83KD )
Related Product Information for anti-PIGR antibody
Description: Rabbit IgG polyclonal antibody for Polymeric immunoglobulin receptor(PIGR) detection. Tested with WB in Human.

Background: Polymeric immunoglobulin receptor is a protein that in humans is encoded by the PIGR gene. It is a Fc receptor which facilitates the secretion of the soluble polymeric isoforms of immunoglobulin A and immunoglobulin M. This gene is mapped to 1q31-q41. The encoded poly-Ig receptor binds polymeric immunoglobulin molecules at the basolateral surface of epithelial cells; the complex is then transported across the cell to be secreted at the apical surface. A significant association was found between immunoglobulin A nephropathy and several SNPs in this gene.
References
1. "Entrez Gene: PIGR polymeric immunoglobulin receptor". 2. Hood L, Kronenberg M, Hunkapiller T (Feb 1985). "T cell antigen receptors and the immunoglobulin supergene family". Cell 40 (2): 225-9. 3. Kaetzel CS (Aug 2005). "The polymeric immunoglobulin receptor: bridging innate and adaptive immune responses at mucosal surfaces". Immunological Reviews 206: 83-99.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83,284 Da
NCBI Official Full Name
polymeric immunoglobulin receptor
NCBI Official Synonym Full Names
polymeric immunoglobulin receptor
NCBI Official Symbol
PIGR
NCBI Protein Information
polymeric immunoglobulin receptor
UniProt Protein Name
Polymeric immunoglobulin receptor
UniProt Gene Name
PIGR
UniProt Synonym Gene Names
PIgR; Poly-Ig receptor
UniProt Entry Name
PIGR_HUMAN

NCBI Description

This gene is a member of the immunoglobulin superfamily. The encoded poly-Ig receptor binds polymeric immunoglobulin molecules at the basolateral surface of epithelial cells; the complex is then transported across the cell to be secreted at the apical surface. A significant association was found between immunoglobulin A nephropathy and several SNPs in this gene.[provided by RefSeq, Sep 2009]

Uniprot Description

PIGR: This receptor binds polymeric IgA and IgM at the basolateral surface of epithelial cells. The complex is then transported across the cell to be secreted at the apical surface. During this process a cleavage occurs that separates the extracellular (known as the secretory component) from the transmembrane segment.

Protein type: Immunoglobulin superfamily; Membrane protein, integral; Receptor, misc.

Chromosomal Location of Human Ortholog: 1q31-q41

Cellular Component: extracellular space; integral to plasma membrane; plasma membrane; receptor complex

Molecular Function: polymeric immunoglobulin receptor activity

Biological Process: detection of chemical stimulus involved in sensory perception of bitter taste; epidermal growth factor receptor signaling pathway; immunoglobulin transcytosis in epithelial cells mediated by polymeric immunoglobulin receptor; receptor clustering; retinal homeostasis

Disease: Iga Nephropathy, Susceptibility To, 1

Research Articles on PIGR

Similar Products

Product Notes

The PIGR pigr (Catalog #AAA178150) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-PIGR Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIGR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the PIGR pigr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PIGR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.