Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Colon, submucosal plexus)

Rabbit NR3C1 Polyclonal Antibody | anti-NR3C1 antibody

NR3C1 antibody - N-terminal region

Gene Names
NR3C1; GR; GCR; GRL; GCCR; GCRST
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
NR3C1; Polyclonal Antibody; NR3C1 antibody - N-terminal region; anti-NR3C1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NVKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLA
Sequence Length
777
Applicable Applications for anti-NR3C1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NR3C1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Colon, submucosal plexus)

Immunohistochemistry (IHC) (Colon, submucosal plexus)
Related Product Information for anti-NR3C1 antibody
This is a rabbit polyclonal antibody against NR3C1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NR3C1 is a receptor for glucocorticoids that can act as both a transcription factor and as a regulator of other transcription factors. This protein can also be found in heteromeric cytoplasmic complexes along with heat shock factors and immunophilins. The protein is typically found in the cytoplasm until it binds a ligand, which induces transport into the nucleus. Mutations in this gene are a cause of glucocorticoid resistance, or cortisol, resistance. The protein encoded by this gene is a receptor for glucocorticoids that can act as both a transcription factor and as a regulator of other transcription factors. This protein can also be found in heteromeric cytoplasmic complexes along with heat shock factors and immunophilins. The protein is typically found in the cytoplasm until it binds a ligand, which induces transport into the nucleus. Mutations in this gene are a cause of glucocorticoid resistance, or cortisol, resistance. Alternate splicing, the use of at least three different promoters, and alternate translation initiation sites result in several transcript variants encoding the same protein or different isoforms, but the full-length nature of some variants has not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86kDa
NCBI Official Full Name
glucocorticoid receptor isoform alpha
NCBI Official Synonym Full Names
nuclear receptor subfamily 3 group C member 1
NCBI Official Symbol
NR3C1
NCBI Official Synonym Symbols
GR; GCR; GRL; GCCR; GCRST
NCBI Protein Information
glucocorticoid receptor
UniProt Protein Name
Glucocorticoid receptor
Protein Family
UniProt Gene Name
NR3C1
UniProt Synonym Gene Names
GRL; GR
UniProt Entry Name
GCR_HUMAN

NCBI Description

This gene encodes glucocorticoid receptor, which can function both as a transcription factor that binds to glucocorticoid response elements in the promoters of glucocorticoid responsive genes to activate their transcription, and as a regulator of other transcription factors. This receptor is typically found in the cytoplasm, but upon ligand binding, is transported into the nucleus. It is involved in inflammatory responses, cellular proliferation, and differentiation in target tissues. Mutations in this gene are associated with generalized glucocorticoid resistance. Alternative splicing of this gene results in transcript variants encoding either the same or different isoforms. Additional isoforms resulting from the use of alternate in-frame translation initiation sites have also been described, and shown to be functional, displaying diverse cytoplasm-to-nucleus trafficking patterns and distinct transcriptional activities (PMID:15866175). [provided by RefSeq, Feb 2011]

Uniprot Description

GR: transcription factor of the nuclear receptor family. Receptor for glucocorticoids (GC). Binds to glucocorticoid response elements (GRE) and modulates other transcription factors. Affects inflammatory responses, cellular proliferation and differentiation in target tissues. Three alternatively spliced isoforms have been described.

Protein type: Transcription factor; DNA-binding; Mitochondrial; Nuclear receptor

Chromosomal Location of Human Ortholog: 5q31.3

Cellular Component: nucleoplasm; membrane; mitochondrial matrix; cytoplasm; cytosol; nucleus

Molecular Function: protein dimerization activity; glucocorticoid receptor activity; protein binding; zinc ion binding; transcription factor activity; steroid binding

Biological Process: transcription from RNA polymerase II promoter; transcription initiation from RNA polymerase II promoter; transcription, DNA-dependent; maternal behavior; adrenal gland development; regulation of glucocorticoid biosynthetic process; chromatin modification; signal transduction; glucocorticoid metabolic process; glucocorticoid mediated signaling; regulation of transcription, DNA-dependent; positive regulation of neuron apoptosis; glucocorticoid receptor signaling pathway; gene expression; positive regulation of transcription from RNA polymerase II promoter; regulation of gluconeogenesis

Disease: Glucocorticoid Resistance, Generalized

Research Articles on NR3C1

Similar Products

Product Notes

The NR3C1 nr3c1 (Catalog #AAA3207804) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NR3C1 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NR3C1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the NR3C1 nr3c1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NVKLYTTDQS TFDILQDLEF SSGSPGKETN ESPWRSDLLI DENCLLSPLA. It is sometimes possible for the material contained within the vial of "NR3C1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.