Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PIGKSample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human PIGK Polyclonal Antibody | anti-PIGK antibody

PIGK Antibody - middle region

Gene Names
PIGK; GPI8
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
PIGK; Polyclonal Antibody; PIGK Antibody - middle region; anti-PIGK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETIKLQQDSEIMESSY
Sequence Length
319
Applicable Applications for anti-PIGK antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human PIGK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PIGKSample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PIGKSample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-PIGK antibody
This gene encodes a member of the cysteine protease family C13 that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This protein is a member of the multisubunit enzyme, GPI transamidase and is thought to be its enzymatic component. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins.
Product Categories/Family for anti-PIGK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35 kDa
NCBI Official Full Name
GPI-anchor transamidase
NCBI Official Synonym Full Names
phosphatidylinositol glycan anchor biosynthesis class K
NCBI Official Symbol
PIGK
NCBI Official Synonym Symbols
GPI8
NCBI Protein Information
GPI-anchor transamidase
UniProt Protein Name
GPI-anchor transamidase
UniProt Gene Name
PIGK
UniProt Synonym Gene Names
GPI8; GPI transamidase; hGPI8; PIG-K
UniProt Entry Name
GPI8_HUMAN

NCBI Description

This gene encodes a member of the cysteine protease family C13 that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This protein is a member of the multisubunit enzyme, GPI transamidase and is thought to be its enzymatic component. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. [provided by RefSeq, Jul 2008]

Uniprot Description

PIGK: Mediates GPI anchoring in the endoplasmic reticulum, by replacing a protein's C-terminal GPI attachment signal peptide with a pre-assembled GPI. During this transamidation reaction, the GPI transamidase forms a carbonyl intermediate with the substrate protein. Belongs to the peptidase C13 family.

Protein type: Glycan Metabolism - glycosylphosphatidylinositol (GPI)-anchor biosynthesis; Protease; Endoplasmic reticulum; EC 3.-.-.-; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1p31.1

Cellular Component: endoplasmic reticulum membrane; membrane; integral to endoplasmic reticulum membrane; GPI-anchor transamidase complex

Molecular Function: protein binding; cysteine-type endopeptidase activity; protein disulfide isomerase activity; GPI-anchor transamidase activity

Biological Process: cellular protein metabolic process; protein folding; attachment of GPI anchor to protein; C-terminal protein lipidation; proteolysis; post-translational protein modification

Research Articles on PIGK

Similar Products

Product Notes

The PIGK pigk (Catalog #AAA3222879) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PIGK Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PIGK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PIGK pigk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VSTPGHRTDL FQRDPKNVLI TDFFGSVRKV EITTETIKLQ QDSEIMESSY. It is sometimes possible for the material contained within the vial of "PIGK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.