Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Flow Cytometry (FC/FACS) (Sample Type: Mouse monocytesbone marrow derived monocytes)

Rabbit RGS10 Polyclonal Antibody | anti-RGS10 antibody

RGS10 antibody - middle region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Applications
Flow Cytometry, Functional Assay, Western Blot
Purity
Affinity Purified
Synonyms
RGS10; Polyclonal Antibody; RGS10 antibody - middle region; anti-RGS10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT
Sequence Length
181
Applicable Applications for anti-RGS10 antibody
Flow Cytometry (FC/FACS), Western Blot (WB)
Homology
Cow: 81%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 90%; Rat: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human RGS10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Flow Cytometry (FC/FACS)

(Sample Type: Mouse monocytesbone marrow derived monocytes)

Flow Cytometry (FC/FACS) (Sample Type: Mouse monocytesbone marrow derived monocytes)
Related Product Information for anti-RGS10 antibody
This is a rabbit polyclonal antibody against RGS10. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: RGS10 inhibits signal transduction by increasing the GTPASE activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. It associates specifically with the activated forms of the G protein subunits G(I)-ALPHA and G(Z)- alpha but fails to interact with the structurally and functionally distinct G(S)-alpha subunit. Activity on G(Z)-alpha is inhibited by palmitoylation of the G-protein.
Product Categories/Family for anti-RGS10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
regulator of G-protein signaling 10 isoform a
NCBI Official Synonym Full Names
regulator of G protein signaling 10
NCBI Official Symbol
RGS10
NCBI Protein Information
regulator of G-protein signaling 10

NCBI Description

Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 10 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. This protein associates specifically with the activated forms of the two related G-protein subunits, G-alphai3 and G-alphaz but fails to interact with the structurally and functionally distinct G-alpha subunits. Regulator of G protein signaling 10 protein is localized in the nucleus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Research Articles on RGS10

Similar Products

Product Notes

The RGS10 (Catalog #AAA3224433) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RGS10 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RGS10 can be used in a range of immunoassay formats including, but not limited to, Flow Cytometry (FC/FACS), Western Blot (WB). Researchers should empirically determine the suitability of the RGS10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DQIFNLMKYD SYSRFLKSDL FLKHKRTEEE EEDLPDAQTA AKRASRIYNT. It is sometimes possible for the material contained within the vial of "RGS10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.