Rabbit anti-Human Phospholipase A2, Secretory, Group IB Polyclonal Antibody | anti-PLA2 antibody

Phospholipase A2, Secretory, Group IB (PLA2G1B, phospholipase A2, MGC119834, MGC119835, Phosphatidylcholine 2-acylhydrolase, Phospholipase A2 precursor, PLA2, PLA2A, PPLA2) (Biotin)

Cat. Num. AAA6389374

• Gene Names: PLA2G1B; PLA2; PLA2A; PPLA2
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Phospholipase A2; Secretory; Group IB; Polyclonal Antibody; Group IB (PLA2G1B; phospholipase A2; MGC119834; MGC119835; Phosphatidylcholine 2-acylhydrolase; Phospholipase A2 precursor; PLA2; PLA2A; PPLA2) (Biotin); anti-PLA2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human PLA2G1B.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-PLA2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human PLA2G1B, aa1-148 (NP_000919.1).
• Immunogen Sequence: MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PLA2G1B expression in transfected 293T cell line by PLA2G1B polyclonal antibody. Lane 1: PLA2G1B transfected lysate (16.4kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-PLA2 antibody

PLA2G1B, hydrolyses the sn-2 ester bond of phospholipids, including those in cell membranes, to generate non-esterified free fatty acids and lysophospholipids. Most secretory PLA2s are stored in cytoplasmic granules and are released into plasma and biological fluids on appropriate cell activation, especially during systemic inflammatory, autoimmune, or allergic disease. PLA2G1B is abundant in digestive organs but is also found elsewhere. Human PLA2G1B shares 78-76aa sequence identity with mouse and rat PLA2G1B, respectively.

Product Categories/Family for anti-PLA2 antibody

Antibodies; Enzymes; Phospholipase

NCBI and Uniprot Product Information

• NCBI GI #: 4505847
• NCBI GeneID: 5319
• NCBI Accession #: NP_000919.1
• NCBI GenBank Nucleotide #: NM_000928.2
• UniProt Accession #: P04054; Q3KPI1; B2R4H5
• Molecular Weight: 16,360 Da
• NCBI Official Full Name: phospholipase A2
• NCBI Official Synonym Full Names: phospholipase A2, group IB (pancreas)
• NCBI Official Symbol: PLA2G1B
• NCBI Official Synonym Symbols: PLA2; PLA2A; PPLA2
• NCBI Protein Information: phospholipase A2; phosphatidylcholine 2-acylhydrolase 1B
• UniProt Protein Name: Phospholipase A2
• Protein Family: Protein terminal ear1
• UniProt Gene Name: PLA2G1B
• UniProt Synonym Gene Names: PLA2; PLA2A; PPLA2
• UniProt Entry Name: PA21B_HUMAN

NCBI Description

This gene encodes a secreted member of the phospholipase A2 (PLA2) class of enzymes, which is produced by the pancreatic acinar cells. The encoded calcium-dependent enzyme catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to release arachidonic acid (AA) and lysophospholipids. AA is subsequently converted by downstream metabolic enzymes to several bioactive lipophilic compounds (eicosanoids), including prostaglandins (PGs) and leukotrienes (LTs). The enzyme may be involved in several physiological processes including cell contraction, cell proliferation and pathological response. [provided by RefSeq, Aug 2013]

Uniprot Description

PLA2G1B: PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. Belongs to the phospholipase A2 family.

Protein type: Lipid Metabolism - arachidonic acid; Secreted, signal peptide; Secreted; Lipid Metabolism - glycerophospholipid; Lipid Metabolism - ether lipid; Phospholipase; Lipid Metabolism - alpha-linolenic acid; EC 3.1.1.4; DNA replication; Lipid Metabolism - linoleic acid

Chromosomal Location of Human Ortholog: 12q24.31

Cellular Component: extracellular space; cell surface; extracellular region; secretory granule

Molecular Function: phospholipase A2 activity; calcium-dependent phospholipase A2 activity; bile acid binding; calcium ion binding; receptor binding

Biological Process: positive regulation of immune response; activation of MAPK activity; neutrophil mediated immunity; activation of phospholipase A2; glucose transport; signal transduction; activation of NF-kappaB transcription factor; phosphatidylcholine metabolic process; positive regulation of fibroblast proliferation; phospholipid metabolic process; fatty acid biosynthetic process; neutrophil chemotaxis; multicellular organismal lipid catabolic process; glycerophospholipid biosynthetic process; actin filament organization; arachidonic acid secretion; leukotriene biosynthetic process; defense response to Gram-positive bacterium; cellular response to insulin stimulus; innate immune response in mucosa; positive regulation of protein secretion; antibacterial humoral response; phosphatidic acid biosynthetic process; positive regulation of transcription from RNA polymerase II promoter; interleukin-8 production; positive regulation of DNA replication