Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of PLA2G1B expression in transfected 293T cell line by PLA2G1B polyclonal antibody. Lane 1: PLA2G1B transfected lysate (16.4kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human Phospholipase A2, Secretory, Group IB Polyclonal Antibody | anti-PLA2G1B antibody

Phospholipase A2, Secretory, Group IB (PLA2G1B, phospholipase A2, MGC119834, MGC119835, Phosphatidylcholine 2-acylhydrolase, Phospholipase A2 precursor, PLA2, PLA2A, PPLA2)

Gene Names
PLA2G1B; PLA2; PLA2A; PPLA2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
Phospholipase A2; Secretory; Group IB; Polyclonal Antibody; Group IB (PLA2G1B; phospholipase A2; MGC119834; MGC119835; Phosphatidylcholine 2-acylhydrolase; Phospholipase A2 precursor; PLA2; PLA2A; PPLA2); Anti -Phospholipase A2; anti-PLA2G1B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PLA2G1B.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS
Applicable Applications for anti-PLA2G1B antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human PLA2G1B, aa1-148 (NP_000919.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of PLA2G1B expression in transfected 293T cell line by PLA2G1B polyclonal antibody. Lane 1: PLA2G1B transfected lysate (16.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PLA2G1B expression in transfected 293T cell line by PLA2G1B polyclonal antibody. Lane 1: PLA2G1B transfected lysate (16.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PLA2G1B antibody
PLA2G1B, hydrolyses the sn-2 ester bond of phospholipids, including those in cell membranes, to generate non-esterified free fatty acids and lysophospholipids. Most secretory PLA2s are stored in cytoplasmic granules and are released into plasma and biological fluids on appropriate cell activation, especially during systemic inflammatory, autoimmune, or allergic disease. PLA2G1B is abundant in digestive organs but is also found elsewhere. Human PLA2G1B shares 78-76aa sequence identity with mouse and rat PLA2G1B, respectively.
Product Categories/Family for anti-PLA2G1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,360 Da
NCBI Official Full Name
phospholipase A2
NCBI Official Synonym Full Names
phospholipase A2, group IB (pancreas)
NCBI Official Symbol
PLA2G1B
NCBI Official Synonym Symbols
PLA2; PLA2A; PPLA2
NCBI Protein Information
phospholipase A2; phosphatidylcholine 2-acylhydrolase 1B
UniProt Protein Name
Phospholipase A2
Protein Family
UniProt Gene Name
PLA2G1B
UniProt Synonym Gene Names
PLA2; PLA2A; PPLA2
UniProt Entry Name
PA21B_HUMAN

NCBI Description

This gene encodes a secreted member of the phospholipase A2 (PLA2) class of enzymes, which is produced by the pancreatic acinar cells. The encoded calcium-dependent enzyme catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to release arachidonic acid (AA) and lysophospholipids. AA is subsequently converted by downstream metabolic enzymes to several bioactive lipophilic compounds (eicosanoids), including prostaglandins (PGs) and leukotrienes (LTs). The enzyme may be involved in several physiological processes including cell contraction, cell proliferation and pathological response. [provided by RefSeq, Aug 2013]

Uniprot Description

Function: PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides, this releases glycerophospholipids and arachidonic acid that serve as the precursors of signal molecules. Ref.9

Catalytic activity: Phosphatidylcholine + H2O = 1-acylglycerophosphocholine + a carboxylate.

Cofactor: Binds 1 calcium ion per subunit

By similarity.

Subunit structure: Monomer or homodimer

By similarity. The inactive pro-form is a homotrimer. Ref.9

Subcellular location: Secreted. Note: secreted from pancreatic acinar cells in its inactive form. Ref.9

Post-translational modification: Activated by trypsin cleavage in the duodenum. Can also be activated by thrombin or autocatalytically.

Sequence similarities: Belongs to the phospholipase A2 family.

Research Articles on PLA2G1B

Similar Products

Product Notes

The PLA2G1B pla2g1b (Catalog #AAA646253) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Phospholipase A2, Secretory, Group IB (PLA2G1B, phospholipase A2, MGC119834, MGC119835, Phosphatidylcholine 2-acylhydrolase, Phospholipase A2 precursor, PLA2, PLA2A, PPLA2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Phospholipase A2, Secretory, Group IB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the PLA2G1B pla2g1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MKLLVLAVLL TVAAADSGIS PRAVWQFRKM IKCVIPGSDP FLEYNNYGCY CGLGGSGTPV DELDKCCQTH DNCYDQAKKL DSCKFLLDNP YTHTYSYSCS GSAITCSSKN KECEAFICNC DRNAAICFSK APYNKAHKNL DTKKYCQS. It is sometimes possible for the material contained within the vial of "Phospholipase A2, Secretory, Group IB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.