Rabbit anti-Human Phospho-TDP-43/TARDB-S409/S410 Polyclonal Antibody | anti-TDP-43/TARDB-S409/S410 antibody
Phospho-TDP-43/TARDB-S409/S410 Rabbit pAb
Gene Names
TARDBP; ALS10; TDP-43
Reactivity
Human
Applications
Western Blot
Purity
Affinity purification
Synonyms
Phospho-TDP-43/TARDB-S409/S410; Polyclonal Antibody; Phospho-TDP-43/TARDB-S409/S410 Rabbit pAb; ALS10; TDP-43; TARDBP; TDP43; anti-TDP-43/TARDB-S409/S410 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA
Applicable Applications for anti-TDP-43/TARDB-S409/S410 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A phospho synthetic peptide corresponding to residues surrounding S409/S410 of Human TDP-43/TARDB.
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Related Product Information for anti-TDP-43/TARDB-S409/S410 antibody
Background: HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20.
Product Categories/Family for anti-TDP-43/TARDB-S409/S410 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
414
NCBI Official Full Name
TAR DNA-binding protein 43
NCBI Official Synonym Full Names
TAR DNA binding protein
NCBI Official Symbol
TARDBP
NCBI Official Synonym Symbols
ALS10; TDP-43
NCBI Protein Information
TAR DNA-binding protein 43; TAR DNA-binding protein-43
UniProt Protein Name
TAR DNA-binding protein 43
UniProt Gene Name
TARDBP
UniProt Synonym Gene Names
TDP43; TDP-43
UniProt Entry Name
TADBP_HUMAN
Similar Products
Product Notes
The TDP-43/TARDB-S409/S410 tardbp (Catalog #AAA9143921) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Phospho-TDP-43/TARDB-S409/S410 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Phospho-TDP-43/TARDB-S409/S410 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the TDP-43/TARDB-S409/S410 tardbp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSEYIRVTED ENDEPIEIPS EDDGTVLLST VTAQFPGACG LRYRNPVSQC MRGVRLVEGI LHAPDAGWGN LVYVVNYPKD NKRKMDETDA SSAVKVKRAV QKTSDLIVLG LPWKTTEQDL KEYFSTFGEV LMVQVKKDLK TGHSKGFGFV RFTEYETQVK VMSQRHMIDG RWCDCKLPNS KQSQDEPLRS RKVFVGRCTE DMTEDELREF FSQYGDVMDV FIPKPFRAFA FVTFADDQIA QSLCGEDLII KGISVHISNA. It is sometimes possible for the material contained within the vial of "Phospho-TDP-43/TARDB-S409/S410, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
