Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: KRT72Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

Rabbit KRT72 Polyclonal Antibody | anti-KRT72 antibody

KRT72 Antibody - C-terminal region

Gene Names
KRT72; KRT6; K6irs; K6IRS2; KRT6IRS2
Reactivity
Cow, Horse, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KRT72; Polyclonal Antibody; KRT72 Antibody - C-terminal region; anti-KRT72 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GFSMGFGASSSYSYKTAAADVKTKGSCGSELKDPLAKTSGSSCATKKASR
Sequence Length
511
Applicable Applications for anti-KRT72 antibody
Western Blot (WB)
Homology
Cow: 100%; Horse: 93%; Human: 100%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human KRT72
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: KRT72Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: KRT72Sample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-KRT72 antibody
This is a rabbit polyclonal antibody against KRT72. It was validated on Western Blot

Target Description: Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells. The type II keratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This gene encodes a type II keratin that is specifically expressed in the inner root sheath of hair follicles. The type II keratins are clustered in a region of chromosome 12q12-q13. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-KRT72 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
keratin, type II cytoskeletal 72 isoform 1
NCBI Official Synonym Full Names
keratin 72
NCBI Official Symbol
KRT72
NCBI Official Synonym Symbols
KRT6; K6irs; K6IRS2; KRT6IRS2
NCBI Protein Information
keratin, type II cytoskeletal 72
UniProt Protein Name
Keratin, type II cytoskeletal 72
Protein Family
UniProt Gene Name
KRT72
UniProt Synonym Gene Names
K6IRS2; KB35; KRT6; KRT6IRS2; CK-72; K72
UniProt Entry Name
K2C72_HUMAN

NCBI Description

Keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells. The type II keratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This gene encodes a type II keratin that is specifically expressed in the inner root sheath of hair follicles. The type II keratins are clustered in a region of chromosome 12q12-q13. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jun 2009]

Uniprot Description

KRT72: Has a role in hair formation. Specific component of keratin intermediate filaments in the inner root sheath (IRS) of the hair follicle (Probable). Belongs to the intermediate filament family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 12q13.13

Cellular Component: keratin filament

Molecular Function: structural molecule activity

Research Articles on KRT72

Similar Products

Product Notes

The KRT72 krt72 (Catalog #AAA3218591) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KRT72 Antibody - C-terminal region reacts with Cow, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KRT72 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KRT72 krt72 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GFSMGFGASS SYSYKTAAAD VKTKGSCGSE LKDPLAKTSG SSCATKKASR. It is sometimes possible for the material contained within the vial of "KRT72, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.